KEGG   Burkholderia ambifaria MC40-6: BamMC406_4384Help
Entry
BamMC406_4384     CDS       T00684                                 

Definition
metallophosphoesterase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BamMC406_4384
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BamMC406_4384
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BamMC406_4384
Enzymes [BR:bac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BamMC406_4384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1457665..1459350
Genome map
AA seq 561 aa AA seqDB search
MSNQDNFPAESNEPAASVSRRGFLKLAGVSGLATAARGLAAARAAASNPDGTPEQVHLTW
GNDPASEVVITWASLAPAVNPRARIVADGEPARTVHGVQRLYTDGLNGETVFTYHARVHG
LKPNTRYRYELTADNDSNAAQPFAATFTTAPRGRAPFRFTSYGDLATPNGAWVLSSPQSR
FAVQAVEQFQPLFHLLNGDLCYANLNPAHQPEVWRDFGNNNQTSAANRPWMPCPGNHEIE
FHNGPQGLDSYLARYTLPENGTRFPGRWYSFRVSSVLFISLDADDVVYQDAAAFVGGPDP
LVPAASTGHAPIEPGTSFYVRGYSNGEQTRWLEHTLRHASHDDDIDWIVVQMHQDALSSS
KTGNGSDKGIREAWLPLFDRYGVDLVLCGHDHDYERSYPVRGCNHRAGVDASTGEVVETL
QPRPVGSTDPDRTTFDTSHGTIHLILGGGGTSAPLDVYGANSATGYVQAKVFTKPNRPVP
GTTANTFVRKPADALEDAIWSARRDTGTGYGIAVFDHDPGKPGGHTTITMRYYHAPGADQ
HPSAQYELFETIELSKKRGER
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccaggacaacttccccgccgagtcgaacgagccggccgcttccgtatcgcgt
cgcggcttcctgaaactggccggcgtctccggcctcgccaccgccgcgcgcgggctcgcg
gccgcccgtgccgccgcgtcgaacccggacggcacacccgagcaggtgcacctgacgtgg
ggcaacgacccggcgtccgaagtcgtgatcacgtgggcgtcgctcgcgccggccgtcaat
ccgcgcgcacgcatcgtcgccgacggcgagccggcacgcacggtgcatggtgttcagcgc
ctctacaccgatggcctgaatggcgaaaccgtgttcacgtaccacgcccgcgtgcacggg
ctgaagccgaacacgcgctaccgctacgaactcacggccgacaacgacagcaatgccgcg
cagccgtttgccgcaaccttcacgaccgcgccgcgcggccgcgcgccgtttcgcttcacg
agctacggcgatctcgcgacgccgaacggcgcgtgggtgctgtcgtcgccgcaaagccgc
ttcgcggtgcaggccgtcgagcagttccagccgctgttccacctgctcaacggcgacctc
tgctatgcgaacctgaaccccgcgcaccagccggaggtgtggcgcgacttcggcaacaac
aaccagacgtcggccgcgaatcgcccgtggatgccgtgccccggcaatcacgagatcgaa
ttccacaacggcccgcaggggctcgactcgtatctcgcgcgctatacgctgcccgagaac
ggcacgcgctttccgggccgctggtacagcttccgcgtgagctcggtgctgttcatctcg
ctcgacgccgacgatgtcgtgtaccaggacgcggccgccttcgtcggcggcccggacccg
ctggtgccggccgcgagcaccggccacgcgccgatcgaaccgggcacgtcgttctacgtg
cgcggctacagcaacggcgagcagacacgctggctcgaacatacgctgcggcacgcgtcg
cacgacgacgacatcgactggatcgtcgtgcagatgcaccaggacgcgctgagttcgtcg
aaaacgggcaatggctcggacaagggcatccgcgaggcgtggctgccgctgttcgaccgt
tacggcgtcgacctcgtgctgtgcggtcacgatcacgactacgagcgcagctacccggtg
cgcggctgcaatcaccgcgcgggcgtcgatgcgtcgaccggcgaagtcgtcgagacgctg
cagccgcgtccggtcggatcgacggatcccgaccgcacgacgttcgatacgagccacggc
acgatccacctgatccttggcggcggtggcaccagcgcgccgctcgacgtgtacggcgcg
aactcggcgaccggctatgtgcaggccaaggtcttcacgaagccgaaccggccggtgccg
ggcacgacggcgaacacgttcgtgcgcaagccggccgatgcgcttgaggatgcgatctgg
tccgcgcgccgcgatacgggcacgggctacgggatcgccgtgttcgatcacgatccgggc
aagccgggcggccacacgacgatcacgatgcgctactaccacgcgccgggcgcggatcag
cacccgagcgcgcagtacgagctgttcgagacgatcgagctgagcaagaagcgcggcgaa
cgctga

DBGET integrated database retrieval system