KEGG   Burkholderia ambifaria MC40-6: BamMC406_4709Help
Entry
BamMC406_4709     CDS       T00684                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BamMC406_4709
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BamMC406_4709
Enzymes [BR:bac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BamMC406_4709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1828795..1830090
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VERSAPDGGDYTQSVDKQGLSRQFLFEGKPQLISVDQFSRDSVEALFRVADVMQPIARRH
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIIEQIATNGHAIEQ
TNDLAAGLRGADVVYATRIQKERFTDESFEGYTPDFQINQALVDSVCKPDTLIMHPLPRD
SRPGANDLSVDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSMRDATWRPPAYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccccagcaagccttcctgcgcgacgcgatgcgccgcctcaacatgacccgc
gaagcgttcgcgaatcgcatcggcgtaagccgtcgcgcgctcgatacgtggctattgccc
gacgactcccaggaatcgcgcggaatgcccgagatcgtcgagcgcttcgtgtcggaaatc
gtcgaacgctcggccccggacggcggcgactatacgcaaagcgtagacaaacaaggactc
tcgaggcaattcctgttcgaaggcaagccgcagctgatctcggtggaccagttctcgcgg
gattcggtcgaggcgctgttccgtgtcgccgacgtgatgcagccgatcgcgcgccgccac
aagatttcgcgcgtgctcgaaggcgccgtgctcggcaacctgttcttcgaagccagcacg
cgcacccgcgtgtcgttcggcgcggccttctgccggctcggcggctcggtatgcgacacg
accggcttcacgttctcgtcgatggccaagggcgaatcgatctacgacacgagccgcgtg
atggccggctatgtcgacgcgctcgtgatccgccacccggagaaaggctcggttgccgaa
ttcgcccgcgcgaccaacctgccggtgatcaacggcggcgacggcccgggcgaacacccg
agccaggcgctgctcgacctctatacgatccagcgcgaattctcgcgactcggcaagatc
gtcgacggcgcgcacatcgcgctcgtcggcgacctgaaatacggccgcaccgtgcattcg
ctcgtcaagctgctcgcgctgtaccgcgggctgaagttcacgctcgtatcgccgccgacg
ctcgaaatgcccgcgtacatcatcgagcagatcgcgacgaacggccacgcgatcgagcag
accaacgacctcgcggccgggctccgcggcgcggatgtcgtctatgcgacgcggatccag
aaggagcgcttcaccgacgagtcgttcgaaggctacacgccggatttccagatcaaccag
gcactcgtcgattccgtctgcaaacccgacacgctgatcatgcacccgctgccgcgcgac
agccggcccggcgcgaacgacctgtcggtcgacctgaaccgcgacccgcgtctcgcgatt
ttccggcagaccgacaacggcattccggtgcggatggcgatcttcgcggtgctgctcggc
gtcgagaatctcgtccagcactcgatgcgcgacgcgacatggcgcccgccggcgtacctc
gggccggaggatgcggtgtttcacgggatcgattga

DBGET integrated database retrieval system