KEGG   Burkholderia ambifaria MC40-6: BamMC406_4784Help
Entry
BamMC406_4784     CDS       T00684                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
Enzymes [BR:bac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BamMC406_4784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1919921..1920367
Genome map
AA seq 148 aa AA seqDB search
MANQPERTGAQGIALIKQFEGLRLARYLDAVGKPTIGYGHLILPNERFTRPLTPAEAEAL
LRRDLRGAELNLRKLLHVPVTQQQFDALMSFVFNLGAGRLRSSTLLRYLNAGARARAADQ
FLVWNKAGGKPLAGLTKRRQAERALFLS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccagcctgaacgcaccggtgcgcagggcatcgcgctgatcaagcagttcgag
ggactgcgcctcgcgcgctatctcgacgcggtcggcaagccgacgatcggctacgggcac
ctgatcctgccgaacgagcgcttcacgcgcccgctcacgcccgccgaagcggaggcgctg
ctgcgccgcgacctgcgcggcgccgagctgaacctgcgcaagctgctgcacgtgccggtc
acgcagcagcagttcgacgcgctgatgtcgttcgtcttcaatctcggcgcgggacggctg
cgctcgtcgacgctgctgcgctacctgaacgccggcgcgcgcgcgcgtgcggccgaccag
ttcctcgtgtggaacaaggccggcggcaagccgctcgcggggctcacgaagcgccgccag
gccgagcgcgcgctgtttctgtcctga

DBGET integrated database retrieval system