KEGG   Burkholderia ambifaria MC40-6: BamMC406_4887Help
Entry
BamMC406_4887     CDS       T00684                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BamMC406_4887
   00330 Arginine and proline metabolism
    BamMC406_4887
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BamMC406_4887
Enzymes [BR:bac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BamMC406_4887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2034036..2034950
Genome map
AA seq 304 aa AA seqDB search
MNYQPILQRIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTIGDAHERFS
IQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVRAETALVEFVRRLIGNNDIDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PETVVDAYCRQCAITMNCVELAQGALFLANGGVAPVTGERILDASSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYSG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagccgatcctccaacgcatccataccgaactcgccccctggatcgggcaa
gggcgggtcgccgactacattcccgagctcgcgaaggtgccggccgacaagttcgggatg
gccgtcgtgacgctcgacggaaacgtttacacgatcggcgacgcgcacgagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagctgctcggcgacgcg
ctgtgggaacgggtcggccgcgagccgtccggcaccgcgttcaattcgctcgtccagctc
gagagcgagcgcggcaagccgcgcaacccgttcatcaacgccggcgcgctggtcgtcacc
gacgtgctgtgccgccgcttcgtgcgcgccgagacggcgctcgtggaattcgtccgacgg
ctgatcggcaacaacgatatcgattacgattcgcgcgtcgcgctgtcggagctccagcac
gcggaacgcaatcgcgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
ccggaaacggtggtcgacgcgtactgccgccagtgcgcgatcacgatgaactgcgtcgag
ctcgcgcaaggcgcgctgtttctcgcgaacggcggcgtcgcgcccgtcaccggcgagcgg
attctcgatgcgagttcggcgaagcggctgtcggcgctgatgctgacctgcggcacctac
gacgcggcgggcgacttcgtctatcgcgtgggactgcccgcgaaaagcggcgtaggcggc
gggatcgtcgcggtgctgccgggcgaaatggccgtgtgcgtgtgggcgccggggctcgac
gcgaacgggaactcgttggcggggacgctggcgctggagtggttgacgacgtattcggga
cggtcgattttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system