KEGG   Burkholderia ambifaria MC40-6: BamMC406_5173Help
Entry
BamMC406_5173     CDS       T00684                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BamMC406_5173
Enzymes [BR:bac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BamMC406_5173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2361149..2362105
Genome map
AA seq 318 aa AA seqDB search
MNDHTHFQPLGGNEMPRCGGIATMMRLPHVASAAGLDACFVGVPFDLGTSNRTGARFGPR
QIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKP
ITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLH
GDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMEEVRARIGDTPVYISF
DIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGAKGLNIVGCDLVEVAPPYDPFGTTALLG
ANLAYELLCVLPGVAYRD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccacacccatttccagccgctcggcggcaatgaaatgccgcgctgcggcggc
atcgcgacgatgatgcgcctgccgcacgtggcgagcgccgcgggcctcgacgcatgcttc
gtcggcgtcccgttcgatctcggcacctccaaccgcaccggcgcacgcttcggcccgcgc
cagatccgcaccgaatccgtgctgctgcgcccgtacaacatggcaacccgcgccgcgccg
ttcgattcgctgcagatcgccgacatcggcgacgtcgcgatcaacccgtacaacctgcac
gattccatcgcgcgcatcgaggccgcatacgacgcgatcctcgagcacgactgcaagccg
atcacgctcggcggcgaccatacgatcgcgctgccgatcctgcgcgcgatccaccgcaag
catggcaaggttgcattgattcacgtcgatgcgcacgccgacgtgaacgatacgatgatg
ggcgaaaagatcgcgcacggcacgccgttccgccgcgcggtcgaggaaggcctgctgcac
ggcgacaaggtcacgcagatcggcctgcgcggcaccggctacgcggcggaggatttcgac
tggtgccgcgagcagggtttccgcgtggtccaggccgaggaatgctggaacaagtcgctc
gcgccgctgatggaagaagtgcgcgcgcgcatcggcgacacgcccgtctacatcagcttc
gacatcgacggcatcgacccggcctacgcgcccggcaccggcacgccggaaatcgccggc
ctgaccgtgccgcaggcgctcgagatcatccgcggcgcgaaggggctgaacatcgtcggc
tgcgatctcgtcgaagtcgcgccgccgtacgacccgttcggcaccacggcgctgctcggc
gcgaacctcgcctacgagctgctgtgcgtgctgcccggcgtcgcataccgcgactga

DBGET integrated database retrieval system