KEGG   Burkholderia ambifaria MC40-6: BamMC406_5420Help
Entry
BamMC406_5420     CDS       T00684                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bac  Burkholderia ambifaria MC40-6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2662807..2663814
Genome map
AA seq 335 aa AA seqDB search
MTDTSRDLVLVTGASGFVGSAVARIAQQKGYAVRVLVRPTSPRTNVVDLDAEIVTGDMRD
EASMRAALRGVRYLLHVAADYRLWAPDPDEIERANLEGAVATMRAARAEGVERIVYTSSV
ATLKVTSAGDPSDENRPLTAEQAIGVYKRSKVLAERAVERMIADEGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFLALERGRIGERYILGGENL
PLQQMLADIAQMTGRKAPTIALPRWPLYPLALGAEAVAKFTKKEPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGLRDALDWFGSAGYLK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacctcccgcgatctcgttctcgtcaccggcgcgtccggtttcgtcggctcg
gccgtcgcgcgcatcgcgcagcagaaaggctatgcggtgcgcgtgctggtgcgcccgacc
agcccgcgcacgaacgtcgtggatctcgacgccgagatcgtcaccggcgacatgcgcgac
gaggcttcgatgcgcgccgcgctgcgcggcgtgcgctacctgctgcacgtcgcggccgac
taccggctgtgggcgccggatccggacgagatcgagcgcgcgaacctcgaaggcgcggtc
gcgacgatgcgcgcggcgcgtgccgaaggcgtcgagcggatcgtctatacgagcagcgtc
gcgacgctgaaggtcacgagcgccggcgatccgtccgacgaaaaccggccgctgaccgcc
gagcaggcgatcggcgtgtacaagcgcagcaaggtgctggccgagcgcgcggtcgagcgg
atgatcgccgacgaagggctgccggccgtgatcgtcaacccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccgcatcatcgtcgaagccgcgctcggcaagatt
cccgcattcgtcgataccggcctgaacctcgtgcatgtcgacgacgtcgcgcacggccac
ttcctcgcgctcgagcgcggccggatcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcaacaaatgctggccgacatcgcgcagatgacgggccgcaaggcgccgacgatc
gcgctgccgcgctggccgctctacccgctcgcgctcggcgcggaggccgtcgcgaagttc
acgaagaaggaaccgttcgtgaccgtcgacgggctgcggatgtcgaagaacaagatgtat
ttcacgtccgcgaaggccgagcgcgagcttggctaccgcgcgcgtccgtaccgcgaaggg
ctgcgcgacgcgctggactggttcggctcggcgggctacctgaaatag

DBGET integrated database retrieval system