KEGG   Burkholderia ambifaria MC40-6: BamMC406_5420Help
Entry
BamMC406_5420     CDS       T00684                                 

Definition
(GenBank) hopanoid-associated sugar epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     BamMC406_5420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NmrA NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short DFP
Motif
Other DBs
NCBI-ProteinID: ACB67864
JGI: BamMC4065420
UniProt: B1Z2A2
Position
2:2662807..2663814
Genome map
AA seq 335 aa AA seqDB search
MTDTSRDLVLVTGASGFVGSAVARIAQQKGYAVRVLVRPTSPRTNVVDLDAEIVTGDMRD
EASMRAALRGVRYLLHVAADYRLWAPDPDEIERANLEGAVATMRAARAEGVERIVYTSSV
ATLKVTSAGDPSDENRPLTAEQAIGVYKRSKVLAERAVERMIADEGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFLALERGRIGERYILGGENL
PLQQMLADIAQMTGRKAPTIALPRWPLYPLALGAEAVAKFTKKEPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGLRDALDWFGSAGYLK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacctcccgcgatctcgttctcgtcaccggcgcgtccggtttcgtcggctcg
gccgtcgcgcgcatcgcgcagcagaaaggctatgcggtgcgcgtgctggtgcgcccgacc
agcccgcgcacgaacgtcgtggatctcgacgccgagatcgtcaccggcgacatgcgcgac
gaggcttcgatgcgcgccgcgctgcgcggcgtgcgctacctgctgcacgtcgcggccgac
taccggctgtgggcgccggatccggacgagatcgagcgcgcgaacctcgaaggcgcggtc
gcgacgatgcgcgcggcgcgtgccgaaggcgtcgagcggatcgtctatacgagcagcgtc
gcgacgctgaaggtcacgagcgccggcgatccgtccgacgaaaaccggccgctgaccgcc
gagcaggcgatcggcgtgtacaagcgcagcaaggtgctggccgagcgcgcggtcgagcgg
atgatcgccgacgaagggctgccggccgtgatcgtcaacccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccgcatcatcgtcgaagccgcgctcggcaagatt
cccgcattcgtcgataccggcctgaacctcgtgcatgtcgacgacgtcgcgcacggccac
ttcctcgcgctcgagcgcggccggatcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcaacaaatgctggccgacatcgcgcagatgacgggccgcaaggcgccgacgatc
gcgctgccgcgctggccgctctacccgctcgcgctcggcgcggaggccgtcgcgaagttc
acgaagaaggaaccgttcgtgaccgtcgacgggctgcggatgtcgaagaacaagatgtat
ttcacgtccgcgaaggccgagcgcgagcttggctaccgcgcgcgtccgtaccgcgaaggg
ctgcgcgacgcgctggactggttcggctcggcgggctacctgaaatag

DBGET integrated database retrieval system