KEGG   Burkholderia ambifaria MC40-6: BamMC406_5443Help
Entry
BamMC406_5443     CDS       T00684                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BamMC406_5443
Enzymes [BR:bac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BamMC406_5443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2682561..2683343)
Genome map
AA seq 260 aa AA seqDB search
MAETLNLTKETLVALAERRLENEVGDSGWSPRQKLALTCRILFDAGHDSGLAGQITCRAG
DAGTYYTQRLGLGFDEISAANLLRVNEDLDVVDGEGIPNPANRFHTWIYRERPDVNCIIH
THPAHVAALSMLEQPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISKALGDKRAIL
LSHHGQLVVGRTIEEACILALLIERAAKLQLLAMSAGEIKPVPPALAREARDWISKPKRD
AVTFDYYARRALRTHPDCIA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgttgaatttgacgaaggagacgctggtcgcgctggcggagcggcgtctc
gagaacgaggtgggcgacagcggctggtccccgcggcaaaagctcgcgctcacgtgccgg
atcctgttcgacgccggtcacgattcgggcctggccgggcagatcacctgccgcgcgggc
gacgccggcacgtactacacgcagcggctggggctcggcttcgacgagatctcggccgcg
aacctgctgcgcgtgaacgaggatctcgacgtcgtcgacggcgaaggcattccgaacccg
gccaaccggttccatacgtggatctatcgcgagcgcccggacgtgaactgcatcatccat
acgcacccggcgcatgtcgcggcgctgtcgatgctcgagcagccgctcgtcgtgtcgcac
atggacacctgcccgctgtacgacgattgcgcgttcctgaaggactggcccggcgtgccg
gtcggcaacgaggaaggcgagatcatttcgaaggcgctcggcgataaacgcgcaattctg
ctgtcgcatcacggccagctcgtggtgggcaggacgatcgaggaagcctgcatcctcgcg
ctgctgatcgagcgggccgcgaagctgcaactgcttgcgatgtcggccggcgagatcaag
ccggtgccgccggcgctcgcgcgggaagcgcgcgactggatttcgaagccgaagcgcgat
gccgtgacgttcgactactacgcgcggcgcgcgttgcgcacgcatccggactgtattgca
tga

DBGET integrated database retrieval system