KEGG   Burkholderia ambifaria MC40-6: BamMC406_5486Help
Entry
BamMC406_5486     CDS       T00684                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BamMC406_5486
Enzymes [BR:bac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BamMC406_5486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2733188..2735179
Genome map
AA seq 663 aa AA seqDB search
MRLGVCYYPEHWPESMWAADARRMKALGIAQVRIAEFAWSRIEPSPGEYDWGWLDRAVDV
LGTAGLEIVMCTPTATPPKWLVDRHPDILAIGADGRPRGFGSRRHYDFSSPTYLEASRQI
CTAVAERYGRHPAVRYWQTDNELGCHQTVVSYSPAALVRFREWLKARYGTIDALNRAWGT
VFWSMEYRHFDEVDAPIGTVTEAHPSHRLDYRRFASDEVARYHRMQVDVIRAHSPGRPVA
HNFMQLFTEFDHYEVARDLDIATWDSYPLGALEEQWFAPELKARWLRTGHPDFASFNHDL
YRGMSKLPFWVMEQQPGPVNWAQWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLHTPDDQLDEGGREAQRVAREIAAVLDAGADADANGAVRAPVALVFDYEAKWLF
EVQPQGADFHYPRCAFEYYSALRSLGLDVDVISAHAPLDGYRLVVVPPLPIVPDDFAARL
AASGAHAVFGPRTGSKTADLQIPPTLPPGPLASILPLRVWRVESLRPNVTEPVDGTLRDG
SAFTGDARRWRDLVELRDDAPSVVRARFADGHPACVSHGALHYWAALFDDATTARLFADV
AAEAGLTPSPLGDGVRVSRRGGLTYVFNYGGTPHTVDGVPPSAFVVGAAQVEPQGVAVYR
SRS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcggagtctgttactacccggaacactggccggaatcgatgtgggccgccgac
gcccgccggatgaaggcgctcggcatcgcgcaggtgcggatcgccgaattcgcgtggagc
cgcatcgagccgtcgccgggcgaatacgactggggctggctcgaccgcgcggtcgacgtg
ctcggtacggccggcctcgagatcgtgatgtgcacgccgaccgcgacgccgccgaaatgg
ctcgtcgaccgtcaccccgacatcctcgcaatcggcgccgatggccggccgcgcgggttc
ggttcgcgccgccactacgacttctcgtcgccgacctatctggaagcgtcccgccagatc
tgcacggcggtcgccgaacgctacggccgccacccggccgtgcgctactggcagaccgac
aacgagctcggctgccaccagacggtggtcagctattcgcccgccgcgctcgtgcgcttt
cgcgaatggctgaaggcccgctacggcacgatcgacgcgctgaaccgcgcgtggggcacc
gtgttctggagcatggagtaccggcatttcgacgaagtcgacgcgcccatcggcaccgtg
accgaagcgcatccgtcgcatcgcctcgactaccggcgcttcgcgtccgacgaggtcgcg
cgctatcaccggatgcaggtcgacgtgatccgcgcgcattcgccgggccggcccgtcgcg
cacaacttcatgcagctgttcaccgagttcgatcattacgaggtggcgcgcgacctcgac
atcgcgacgtgggacagctacccgctcggcgcgctcgaggagcaatggttcgcacccgag
ctgaaggcgcgctggctgcgcaccggccatccggatttcgcgtcgttcaatcacgatctc
tatcgcgggatgtcgaagctgccgttctgggtgatggagcagcagccggggcccgtgaac
tgggcgcagtggaaccccgcgccgctgccgggcatggtgcgcctgtggagctgggaagcg
ttcgcgcacggcgccggctgcgtgtcgtacttccgctggcggcaggcgccgttcgcgcag
gagcagatgcatgcgggcctgcacacgccggacgaccagctcgacgaaggcggccgcgaa
gcgcagcgcgtcgcgcgcgaaatcgcggccgtgctcgacgccggcgccgatgccgacgcg
aacggcgcggtgcgcgcccccgtcgcgctggtgttcgactatgaagcgaagtggctgttc
gaagtgcagccgcaaggcgccgatttccactacccgcgctgcgcgttcgagtactactcg
gcgctgcgttcgctcggcctcgacgtcgacgtgatctccgcgcatgcgccgctcgacggc
taccggctcgtcgtcgtgccgccgctgccgatcgtgccggacgacttcgcggcccggctc
gccgcatcgggcgctcatgcggtgttcggcccgcgcaccggttcgaagacggccgacctg
cagattccgccgacgctgccgcccggcccgctcgcgtcgatcctgccgctgcgcgtgtgg
cgcgtcgagtcgctgcggccgaacgtgaccgagccggtcgacggaacgttgcgcgacggc
tcggcgttcaccggcgacgcacgccgctggcgcgacctcgtcgagctgcgcgacgatgca
cccagcgtcgtgcgtgcgcgcttcgccgacggtcatccggcctgcgtgtcgcacggcgcg
ctgcactactgggccgcgctgttcgatgacgcgaccaccgcgcgcctgttcgccgacgtc
gcggccgaagccggcctgacaccgtcgccgctcggcgacggcgtgcgcgtgagccgacgc
ggcggcctgacctacgtattcaactacggcggcacgccgcatacggtcgatggggtgccg
ccgtccgcgttcgtggtcggcgccgcgcaggtcgagccgcaaggcgtcgccgtgtatcga
agccgttcgtag

DBGET integrated database retrieval system