KEGG   Burkholderia ambifaria MC40-6: BamMC406_5692Help
Entry
BamMC406_5692     CDS       T00684                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BamMC406_5692
Enzymes [BR:bac01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     BamMC406_5692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(205122..205496)
Genome map
AA seq 124 aa AA seqDB search
MSNDTKVLADRVIRAFEARDIHSVSALLADDVRLEDVPLGAHVGKHAVVEKITDFFGKAS
AYRWERHRVITQDNTAIVERTSHIALGGKEIKLPMLVILEFDANGKLSLFKDYFDLKTLE
QQLA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgatacgaaagtgcttgccgaccgcgtcattcgcgcattcgaggcgcgcgat
atccattcggtatcggcgctgcttgccgacgacgtccgtctcgaggacgtgccgctcggc
gcccatgtcggcaagcatgccgtcgtcgaaaagataacggactttttcggcaaggcgagc
gcctatcgttgggagcgtcaccgcgtgatcacgcaggacaacacggcgatcgtcgaacgc
acgagccatatcgcgctgggcggaaaggagattaagctgccgatgctcgtgattctcgag
ttcgacgcgaacggcaagctgtcgctcttcaaggactatttcgacctgaagacgctggaa
cagcagctcgcataa

DBGET integrated database retrieval system