KEGG   Burkholderia ambifaria MC40-6: BamMC406_5692Help
Entry
BamMC406_5692     CDS       T00684                                 

Definition
(GenBank) protein of unknown function DUF1486
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BamMC406_5692
Enzymes [BR:bac01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     BamMC406_5692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 LEH SnoaL DUF4440 SnoaL_3
Motif
Other DBs
NCBI-ProteinID: ACB68135
JGI: BamMC4065692
UniProt: B1Z5T9
Position
3:complement(205122..205496)
Genome map
AA seq 124 aa AA seqDB search
MSNDTKVLADRVIRAFEARDIHSVSALLADDVRLEDVPLGAHVGKHAVVEKITDFFGKAS
AYRWERHRVITQDNTAIVERTSHIALGGKEIKLPMLVILEFDANGKLSLFKDYFDLKTLE
QQLA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgatacgaaagtgcttgccgaccgcgtcattcgcgcattcgaggcgcgcgat
atccattcggtatcggcgctgcttgccgacgacgtccgtctcgaggacgtgccgctcggc
gcccatgtcggcaagcatgccgtcgtcgaaaagataacggactttttcggcaaggcgagc
gcctatcgttgggagcgtcaccgcgtgatcacgcaggacaacacggcgatcgtcgaacgc
acgagccatatcgcgctgggcggaaaggagattaagctgccgatgctcgtgattctcgag
ttcgacgcgaacggcaagctgtcgctcttcaaggactatttcgacctgaagacgctggaa
cagcagctcgcataa

DBGET integrated database retrieval system