KEGG   Burkholderia ambifaria MC40-6: BamMC406_5727Help
Entry
BamMC406_5727     CDS       T00684                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00620  Pyruvate metabolism
bac00640  Propanoate metabolism
bac00680  Methane metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_5727
   00620 Pyruvate metabolism
    BamMC406_5727
   00640 Propanoate metabolism
    BamMC406_5727
  Energy metabolism
   00680 Methane metabolism
    BamMC406_5727
Enzymes [BR:bac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BamMC406_5727
Lipid biosynthesis proteins [BR:bac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BamMC406_5727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACB68169
JGI: BamMC4065727
UniProt: B1Z5X3
Position
3:complement(238993..240666)
Genome map
AA seq 557 aa AA seqDB search
MRDGATAREVPAYADAVAGFRIETAAAYLHGDLEQGLNACVECCDRHAAADPNAIALDWI
DAGGRHRSFTFAQMQALSARVANLLVEQGVKPGDVVAGLLPRTPELVATILGTWRAGAVY
QPLFTAFGPKAIEHRLRMSDARLIVTNIANRAKLDEIVDCPPVATVREPGDTLPARDIDF
RTALDAQSGTFEPVLRKGTDLFMMMSTSGTTGLPKGVPVPLRALLAFGAYMRDAVDLRPS
DRFWNIADPGWAYGLYYAITGPLLLGHATTLYEGSFTVDSTCDVIERLGITSLAGSPTAY
RMLMAAGTEVAARLKGQLRVVSSAGEPLNPEVVRWFHAALGAPIHDHYGQTELGMVVNNH
HGLTHVVHVGSAGLAMPGYRVAVLDEAGRELGPGEPGNLAIDIARSPLLWFTGYWQQDTP
AIASGYYRTGDNVELEPDGTVSFIGRADDVITSSGYRIGPFDVESALIEHPAVSEAAVIG
VPDPERTEIVKAFVVLSKGFEGTPALADELSQHVKRRLSAHAYPRAIDFVDALPKTPSGK
IQRFVLRKMEAEKTAQS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatggagcaactgcccgggaggtgccggcctacgccgacgccgtggccggcttc
cgtatcgagaccgccgccgcatatctgcacggcgacctggagcagggcctgaacgcctgc
gtcgaatgctgcgaccggcatgcggcggcggacccgaacgcgatcgcactcgactggatc
gacgctggcggcaggcatcgcagtttcacgttcgcgcagatgcaggcgctgtcggcgcgc
gtcgcgaacctgctggtcgagcagggcgtgaagccgggtgacgtggtggccggcctgttg
ccgcgcacgcccgaactcgtcgcgacgatcctcggcacgtggcgcgcgggcgccgtctac
cagccgcttttcaccgcgttcggaccgaaggcgatcgagcaccggctgcgcatgagcgat
gcgcggctgatcgtcaccaacatcgcgaatcgcgcgaagctcgacgagatcgtggattgc
ccgccggtggcgacggtgcgcgagccgggcgacacgctgccggcccgcgatatcgatttc
cgtacggcactcgatgcgcagtcaggcacgttcgaaccggtgctgcgcaaggggaccgac
ctgttcatgatgatgtcgacgtcgggcacgacgggtttgccgaagggcgtgccggtgccg
ctgcgcgcactgcttgcgttcggcgcatacatgcgcgacgcggtggacctgcgccccagc
gaccgcttctggaacatcgccgatccgggttgggcatacggtctctactacgcgatcacg
ggcccgctgctgctcggccatgcgacgacgctgtacgaaggcagcttcaccgtcgacagc
acctgcgacgtgatcgaacggctcggcatcacgagcctcgccggttcgccgaccgcgtac
cggatgctgatggcggccggcaccgaagtggcggcacggctgaaagggcaactgcgggtc
gtcagcagcgcgggcgaaccgctgaatccggaagtcgtgcgctggttccacgcggcgctc
ggcgcgccgatccacgatcactacggccagaccgaactcgggatggtcgtgaacaaccat
cacgggctcacgcacgtcgtccatgtcggttcggccggtctcgcgatgcccggctatcgc
gtcgcggtactcgacgaagccggtcgcgagctcggcccgggcgagcccggtaacctcgcg
atcgacatcgcacgctcgccgctgctgtggttcaccggctactggcagcaggatacgccg
gcgatcgcgagcggctactaccggaccggcgacaacgtcgaactcgagccggacggcacc
gtgagcttcatcggccgcgcggacgacgtgatcacgtcgtccggttaccggatcggcccg
ttcgacgtggaaagcgcgctgatcgagcatccggccgtcagcgaggccgcggtgatcggc
gtgccggatccggagcgcacggagatcgtcaaggcgttcgtcgtgctgtcgaaaggtttt
gaaggcacgccggcgctggccgacgaactgagccagcacgtgaagcggcggctgtcggcg
cacgcgtatccgcgcgcgatcgacttcgtcgacgcgctgccgaaaaccccgagcggcaag
atccagcgcttcgttttgcgcaagatggaagccgagaagaccgctcaatcctga

DBGET integrated database retrieval system