KEGG   Burkholderia ambifaria MC40-6: BamMC406_6213Help
Entry
BamMC406_6213     CDS       T00684                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bac01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bac01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bac00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bac00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bac00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bac00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bac00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:802211..803146
Genome map
AA seq 311 aa AA seqDB search
MTDIATVTLNPAVDVSTSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCVALYL
TGGPTGDVLTQLIEAERLPSMRIRIAGETRENVCVTETATGREYRFLMPGPLVTEAEWRD
CAARIEAMQPAPRYLVLSGSLPPGAPDDLYARLARKARAKGSRVVVDAAGRALQAALEAG
VHLVKPSLGELSALAGEPLDDTSACRKASELVAQGQADIVALTLGARGAWVVTRDRALRL
PGRPAAVCSTVGAGDSFVGGMVWALARGMPFDDACRYALAASAASVEHPGTALCTRDDVE
RIHAELAAQAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgctaccgtcacattgaatccggccgtcgatgtctcgacgtcggtcgag
cacatcgtcgatacgcacaagctgcgctgcgcacggccgcggcgcgaccccggcggcggc
ggaatcaacgtcgcccggaccattcaccggctcggcggcgactgcgtcgcgctgtacctg
accggcgggccgaccggtgacgtcttgacgcagctgatcgaggccgagcgcctcccgagc
atgcgaatccggatcgccggcgagacgcgtgagaacgtctgcgtgaccgagacagcgacc
gggcgggaataccgtttcctgatgccggggccgctcgtcacggaggccgagtggcgcgac
tgcgcggcccgcatcgaagcgatgcaaccggcgccacgctatctcgtgttgagcggcagc
ctgccgcccggcgcgccggacgatctctatgcgaggcttgcgcgcaaggccagggcgaag
ggcagccgcgtggtcgtcgatgcggcgggccgggcgctgcaggcggccctcgaggccggc
gtccatctcgtgaagcccagtctcggcgaactgagtgcgctggccggcgaaccgctcgac
gacacgtcggcatgccggaaggcgagcgaactcgtcgcgcaaggccaggccgacatcgtc
gcgttgacgctcggtgcacgcggcgcatgggtcgtcacgcgggatcgcgcgctgcgcctg
cccggcaggccggcagcggtatgcagcacggtcggcgccggcgacagtttcgtcggcggc
atggtctgggcactggcgcgtggcatgccgttcgacgatgcgtgccgctacgcgctggcg
gcgtcggctgcgtcggtcgagcatcccggtacggcgctgtgcacgcgcgacgatgtcgag
cggattcatgccgaactggctgcgcaggcaagctga

DBGET integrated database retrieval system