KEGG   Burkholderia ambifaria MC40-6: BamMC406_6213Help
Entry
BamMC406_6213     CDS       T00684                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BamMC406_6213
   01230 Biosynthesis of amino acids
    BamMC406_6213
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_6213
   00030 Pentose phosphate pathway
    BamMC406_6213
   00051 Fructose and mannose metabolism
    BamMC406_6213
   00052 Galactose metabolism
    BamMC406_6213
  Energy metabolism
   00680 Methane metabolism
    BamMC406_6213
Enzymes [BR:bac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BamMC406_6213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:802211..803146
Genome map
AA seq 311 aa AA seqDB search
MTDIATVTLNPAVDVSTSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCVALYL
TGGPTGDVLTQLIEAERLPSMRIRIAGETRENVCVTETATGREYRFLMPGPLVTEAEWRD
CAARIEAMQPAPRYLVLSGSLPPGAPDDLYARLARKARAKGSRVVVDAAGRALQAALEAG
VHLVKPSLGELSALAGEPLDDTSACRKASELVAQGQADIVALTLGARGAWVVTRDRALRL
PGRPAAVCSTVGAGDSFVGGMVWALARGMPFDDACRYALAASAASVEHPGTALCTRDDVE
RIHAELAAQAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgctaccgtcacattgaatccggccgtcgatgtctcgacgtcggtcgag
cacatcgtcgatacgcacaagctgcgctgcgcacggccgcggcgcgaccccggcggcggc
ggaatcaacgtcgcccggaccattcaccggctcggcggcgactgcgtcgcgctgtacctg
accggcgggccgaccggtgacgtcttgacgcagctgatcgaggccgagcgcctcccgagc
atgcgaatccggatcgccggcgagacgcgtgagaacgtctgcgtgaccgagacagcgacc
gggcgggaataccgtttcctgatgccggggccgctcgtcacggaggccgagtggcgcgac
tgcgcggcccgcatcgaagcgatgcaaccggcgccacgctatctcgtgttgagcggcagc
ctgccgcccggcgcgccggacgatctctatgcgaggcttgcgcgcaaggccagggcgaag
ggcagccgcgtggtcgtcgatgcggcgggccgggcgctgcaggcggccctcgaggccggc
gtccatctcgtgaagcccagtctcggcgaactgagtgcgctggccggcgaaccgctcgac
gacacgtcggcatgccggaaggcgagcgaactcgtcgcgcaaggccaggccgacatcgtc
gcgttgacgctcggtgcacgcggcgcatgggtcgtcacgcgggatcgcgcgctgcgcctg
cccggcaggccggcagcggtatgcagcacggtcggcgccggcgacagtttcgtcggcggc
atggtctgggcactggcgcgtggcatgccgttcgacgatgcgtgccgctacgcgctggcg
gcgtcggctgcgtcggtcgagcatcccggtacggcgctgtgcacgcgcgacgatgtcgag
cggattcatgccgaactggctgcgcaggcaagctga

DBGET integrated database retrieval system