KEGG   Burkholderia ambifaria MC40-6: BamMC406_6322Help
Entry
BamMC406_6322     CDS       T00684                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00500  Starch and sucrose metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BamMC406_6322
Enzymes [BR:bac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BamMC406_6322
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BamMC406_6322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ACB68754
JGI: BamMC4066322
UniProt: B1Z4U1
Position
3:922633..924834
Genome map
AA seq 733 aa AA seqDB search
MTDMLFDRTDIDALLAGRHPDPFACLGPHADAGRVVVRALLPGAQRVRAVTPDGDELGAL
ACVDDAGCFAGTLAHDGRYRLAIDWPDARQITDDAYAFGTLLDEAALARFASGDPAAVLD
CLGATPTRVDGIDGVRFAVWAPNAQRVSVVGDFNMWDGRRHPMRLRRPWGVWELFVPGIG
AGEHYKYELRAADGHVLPHKADPCARATEAPPRTASVVADTAALDAFAWHDDGWLHARPP
ADRRFRMPWSIYEVHPESWQRVPEEMDRSATWDELAERLIPYVRGMGFTHVEFMPISEYP
FGGSWGYQPLAQFAPSARFGPVEGFARFVDRAHAAGIGVIVDWVPAHFPNDAHGLAQFDG
SALYEHADPREGMHPDWNTCVFNLGRNEVGAFLIASALAWARRYHVDGIRVDAVASMLYR
DYSRNEGEWVPNIHGGRENLESVAFLRTLNDTLHGALAPPGVVTFAEESTAWPGVTASTG
DGGLGFDFKWNMGWMHDTLSYVREDPIHRRYHHDRMTFGLVYAFSERFVLPLSHDEVVHG
KGSLAVKMPGDAWQRLATLRAYFGFMWAHPGKKLLFMGSEFAQWAEFAHDATPHWDLLDA
PAHRGVQRLVRDLNRTYAAEPALHALDCHASGFFWLIGDDRDNSVFAFARRDDTGRLVVA
ICNFTPVPRPGYRIGLPAPGHWRELMNTDAAVYGGTNAGNDGAVWTEDVPSHGQSWSATL
RLPPLATLWLSPA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatgctgttcgaccgcaccgacatcgacgcgctgctcgccggccgccatccg
gacccgttcgcgtgtctcggcccgcacgccgacgccggccgggtcgtcgtgcgcgcgctg
ctgcccggcgcgcagcgcgtgcgggcggtgacgcccgacggcgacgaactcggcgcgctc
gcgtgcgtcgacgacgccggctgcttcgcgggcacgctcgcgcacgacggccgctaccgg
ctggccatcgactggccggacgcccgccagatcaccgacgacgcgtatgcgttcggcacg
ctgctcgacgaggccgcgctcgcgcgtttcgcgtccggcgacccggccgccgtgctcgac
tgcctgggcgcgacgcccacgcgcgtcgacggcatcgacggcgtgcgcttcgcggtgtgg
gcgccgaacgcgcagcgcgtatcggtcgtcggcgacttcaacatgtgggacggccgtcgg
catccgatgcggctgcgccggccgtggggcgtgtgggagctgttcgtgccgggcatcggc
gccggcgaacactacaagtacgagctgcgcgcggccgacggacacgtgctgccgcacaag
gccgacccgtgcgcgcgcgcgaccgaagcgccgccgcgcaccgcgtccgtcgtcgccgac
accgcggcgctcgacgcgttcgcgtggcacgacgacggctggctgcacgcgcggccgccc
gcggaccggcgctttcgcatgccgtggtcgatctacgaggtgcatccggaatcgtggcag
cgcgtgcccgaggagatggaccgcagcgcgacctgggacgaactcgccgagcggttgatc
ccgtatgtgcgcggcatgggcttcacacacgtcgaattcatgccgatttccgaatacccg
ttcggcggttcgtggggctaccagccgctcgcgcagtttgcgccctcggcgcgcttcggc
ccggtcgagggattcgcgcgcttcgtcgaccgcgcgcacgcggccggcatcggcgtgatc
gtcgactgggtgcccgcgcacttcccgaacgacgcgcacggcctcgcgcaattcgacggc
agcgcactgtacgagcacgccgatccgcgtgaaggcatgcacccggactggaacacctgc
gtgttcaatctcggacgcaacgaggtcggcgcgttcctcatcgcgtcggcgctcgcgtgg
gcgcgccgttatcacgtcgacgggatccgcgtcgatgcggtcgcgtcgatgctgtaccgc
gactactcgcgcaacgaaggcgaatgggtgcccaacatccacggcgggcgcgagaacctc
gaatccgtcgcgttcctgcgcacgctcaacgacacgctgcacggtgcgctcgcgccgccg
ggcgtcgtcaccttcgcggaggaatcgaccgcgtggccgggcgtcacggcgtcgaccggc
gacggcgggctcggcttcgacttcaaatggaacatggggtggatgcacgacacgctgtcg
tatgtacgcgaggatccgatccatcgccgctaccatcatgaccggatgacgttcgggctc
gtctatgcgttctccgaacgattcgtgctgccgctgtcgcacgacgaggtcgtgcacggc
aagggttcgctcgccgtgaagatgccgggcgacgcgtggcagcggctcgcgacgctgcgc
gcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctgttcatgggcagcgaa
ttcgcgcaatgggccgagttcgcgcacgatgcgacgccgcactgggacctgctcgacgca
ccggcgcatcgcggcgtgcagcggctcgtgcgcgacctgaaccgcacctacgcggccgag
ccggcgctgcacgcgctcgactgtcacgcgtccggttttttctggctgatcggcgacgat
cgcgacaacagcgtgttcgcgttcgcgcgccgcgacgataccgggcgcctcgtcgtcgcg
atctgcaacttcacgcccgtgccgcgccccggctatcgcatcgggctgcccgcgcccggg
cactggcgcgaactgatgaacaccgatgccgccgtgtatggcggcacgaatgccggcaac
gacggcgccgtgtggacggaggacgtgccgtcgcacggccagtcgtggtcggccaccttg
cgcctgccgccgctcgcgaccctatggctgagcccggcctga

DBGET integrated database retrieval system