KEGG   Burkholderia ambifaria MC40-6: BamMC406_6325Help
Entry
BamMC406_6325     CDS       T00684                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BamMC406_6325
Enzymes [BR:bac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BamMC406_6325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:928861..931092
Genome map
AA seq 743 aa AA seqDB search
MTTDVPIAELARAAGLEPDWIDAGGVARRVADDSLVALVDALGWPCGTPIERVDSAAALL
DAHDAAPPVVTGDAGVPLTLPRSVAPRGARWRITLESGEHVDGRVAGAGEYGRLPPLALP
GYHTLDIGEHRIGLAIAPPRAQPFAAADGLPDAPRRWGISAQLYGLRRAGDDGAGDYTAL
AGLAAQAARHGADAVAISPTHAGYPALPEHDSPYSPSSRRWHNVAYLDCDAVPGTDVVRR
TNGAAADVAPAPDTPLIDWPQVLPLKLRRLRACFDAWRANGAPSRDAFEQFRAAGGAALD
AHARFDALQAFCIEHGIGADWRHWPAQWRMPATAEVDAFAHAHADAIAFHTFLQWCASRA
LGDAQQAARDAGMAVGLIADLAVGSDRAGSDAWAHGTTLLRGVSVGAPPDLFNADGQAWG
VTTWTPAALRANGFTPFIDLLRAALAHAGGIRIDHVLGFARMWIVPEGGSARDGAYLRYP
LDDLVRLVALEAARHRAVAIGEDLGTVPAGFRERLGAQGIAGMRVLWFERDADRAFRPPS
AWDRDTIAMTSTHDLPTVAGWWRGVDLEWRRVAAEAAAAPAKPHPAGDDVGRAAAAHDTG
HDARIDPVLRSDAPAQDDGRDAPPPASFDLRAAQDERTTDRAALWRALQHAGCVPAGDPI
PSADTPPVGAVLAYVARSPSPLAIVPLEDLLALNEQPNLPGPPCGHPNWLRRLPRAVDAL
FDADVRTRIAAIEHARRAPEDDA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacgtaccgatcgccgaactcgcgcgcgcggccgggctcgaacccgactgg
atcgacgcgggcggcgtcgcacggcgggtggccgacgattcgctcgtcgcgctcgtcgat
gcgctcggctggccctgcggcacgccgatcgagcgggtcgacagcgcggccgcgctgctc
gatgcgcacgacgccgcgccccccgtcgtgacgggcgacgcgggcgtgccgctgacgctg
ccgcgcagcgtcgcgccgcgcggcgcgcgctggcggatcacgctggaatcgggcgagcac
gtcgacgggcgcgtggccggcgcgggcgaatacggcaggctgccgccgctcgcgctgccc
ggctatcacacgctcgacatcggcgagcaccgtatcgggctcgcgatcgcgccgccgcgc
gcgcagccgtttgcggctgccgacggcctgccggatgcgccgcgccgctggggcatctcg
gcccagctctacggcctgcggcgcgcgggtgacgacggcgcgggcgactacaccgcgctc
gcgggcctcgccgcacaggccgcgcggcacggcgccgacgcggtcgcgatcagcccgacg
cacgccggctatccggcgctgcccgagcatgacagcccgtattcgccgtcgtcgcggcgc
tggcacaacgtcgcgtatctcgactgcgatgccgtcccgggcaccgatgtcgtgcggcgc
acgaatggcgcggcggcggacgtcgcacccgcgccggatacgccgctgatcgactggccg
caggtgctgccgctgaaactgcgccgcctgcgcgcgtgcttcgatgcatggcgtgcgaac
ggcgcgccctcgcgcgacgcgttcgagcagtttcgcgcggcgggcggggcggcactcgac
gcgcatgcgcgcttcgatgcgctgcaggcgttctgcatcgaacacgggatcggcgcggac
tggcgccactggcccgcgcagtggcggatgccggccaccgccgaggtcgacgcattcgcg
catgcgcacgccgacgcgattgcgttccacacgttcctgcaatggtgcgcgtcgcgcgcg
ctcggcgacgcgcagcaggcggcgcgcgatgccgggatggcggtcgggctgatcgccgac
ctcgcggtcggatccgatcgcgcgggcagcgacgcgtgggcgcacggcacgacgctgttg
cgcggcgtgtcggtcggcgccccgcccgacctgttcaatgcggacggccaggcgtggggc
gtgacgacgtggacacccgccgcgctgcgcgcgaacggcttcacgccgttcatcgacctg
ttgcgcgcggccctcgctcacgccggcgggattcgcatcgatcatgtgctcggcttcgcg
cgcatgtggatcgtgccggaaggcggatcggcgcgcgacggcgcgtacctgcgttatccg
ctcgacgatctggtgcggctcgtcgcgctggaggccgcgcggcaccgggcggtcgcgatc
ggcgaggatctgggcacggtgccggcgggtttccgcgagcggctcggcgcgcagggcatc
gccgggatgcgcgtgctgtggttcgaacgcgacgcggatcgcgcgtttcggccgccgtcc
gcgtgggatcgcgacacgatcgcgatgacgtcgacgcacgacctgccgaccgtggccggc
tggtggcggggtgtcgatctcgaatggcggcgggtggcggccgaggccgctgcggcgccg
gccaagccgcaccctgccggtgacgacgtcggccgcgccgcggccgcacacgacaccggc
cacgacgcacggatcgatccggtcctgcgtagcgatgcgcccgcccaggatgacggccgc
gacgcgccgccccccgcttctttcgacctccgcgccgcccaggacgaacgcaccaccgac
cgcgcggcgctgtggcgcgcgttgcagcacgctggctgcgtaccggccggcgatccgatc
ccgtccgccgacacgccgcccgtcggcgcagtcctcgcgtacgtcgcgcgcagcccgtcg
ccgctcgcgatcgtgccgctcgaggatctgctcgcgctcaacgagcaaccgaatctcccc
ggcccgccgtgcggccatccaaactggctgcgccggctgccgcgcgcggtcgacgcgctg
ttcgacgccgacgtgcgcacacgcatcgcggcgatcgagcacgcgcgccgagcgccggag
gacgacgcatga

DBGET integrated database retrieval system