KEGG   Burkholderia ambifaria MC40-6: BamMC406_6480Help
Entry
BamMC406_6480     CDS       T00684                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_6480
   00052 Galactose metabolism
    BamMC406_6480
Enzymes [BR:bac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BamMC406_6480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(1103282..1104454)
Genome map
AA seq 390 aa AA seqDB search
MKRLWPLHPLHSLLAICALATFGPYATAASTAPDVTLGRADYGTTAAGQAVSQYTLANAR
GVTLKLITYGGIVTTLEVPDRTGKIADIVLGFDSLRDYEAHNGNIHFGALIGRYANRIAH
GCFTLGGKTWTLPVNDPPNTLHGGPDSFDAKVWTVTGTHSDGNGASVTLRYVSPDGENGF
PGTLTTDVTYTLTRDNLIRIDYRATTDQATVVNLTNHSYFNLAGQDGGSVERQLIEIAAS
RFTPTDATSIPTGQLASVAGTPMDLRQLTPIGAHLRDNDAQLVVAHGYDQNWVLDQGGQS
APAFAARAYDPTSGRFLEVYTTQPGLQFYTSNGLNGSVAGKGGRAYRQTDAFALEAEHFP
DSPNHPSFPTTVLKPGQTLHEVTVWKVGAR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactttggccgctccacccgcttcactcgctactcgcgatctgtgcgctcgca
acgttcgggccatacgcaaccgccgcatcgacggcgcccgacgtgaccctcggccgcgcg
gactacggcacgaccgccgcggggcaggcggtgagccagtacacgctggccaacgcgcgc
ggcgtgacgctgaagctcatcacgtacggcggcatcgtgaccacgctcgaggtgcccgac
cgcaccggcaagatcgccgacatcgtgctcggcttcgattcgctgcgcgactacgaagcg
cacaacggcaacatccacttcggcgcgttgatcggccgttatgcgaaccgcattgcacac
gggtgcttcacgctcggcggcaagacgtggacgctgccggtcaacgatccgccgaacacg
ctgcacggcggccccgacagtttcgacgcgaaggtgtggacggtgaccggcacgcacagc
gatggcaacggggcgagcgtgacgctgcgttacgtgagccccgacggcgagaacggcttc
cccggcacgttgacgacggacgtgacctacacgctgacccgcgacaacctgatccgcatc
gactatcgcgcgacgacggaccaggccacggtcgtcaacctgaccaaccacagctatttc
aacctcgcggggcaggatggcgggagcgtcgagcggcagttgatcgagatcgccgcgtcg
cgcttcacgccgaccgacgccacgtcgatcccgaccgggcaactcgcgagcgtggcgggc
acgccgatggacctgcgccagttgacgccgatcggcgcgcatctgcgtgacaacgatgcg
cagctcgtcgtcgcgcatggctacgaccagaactgggtgctcgaccagggcggccagtcg
gccccggcgtttgccgcgcgcgcgtacgatccgacgtccgggcggtttctcgaggtgtac
acgacgcaaccggggctgcagttctatacgtccaacgggttgaacggcagcgtcgcgggc
aagggcgggcgggcttaccggcagaccgacgcgttcgcgctggaagccgagcacttcccc
gattcgccgaaccatccgtcgttcccgacgaccgtgctcaagccggggcagacgctgcac
gaggtgacggtatggaaggtgggcgcgcgatga

DBGET integrated database retrieval system