KEGG   Bacteroides sp. CF50: BRDCF_02975Help
Entry
BRDCF_02975       CDS       T02861                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bacc  Bacteroides sp. CF50
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bacc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRDCF_02975
Enzymes [BR:bacc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BRDCF_02975
Exosome [BR:bacc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRDCF_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
686818..688806
Genome map
AA seq 662 aa AA seqDB search
MEELKLIEDDPWLVPYRRDILRRYQKAVTKRQELAGYGKPLYKSVNSHLYYGVHRTGNSW
FFREWAPGATAIYLIGTFNNWKIEKKYTLSSKGNGDWELELPAESVRQGDLFKWYVYWNG
GEGERMPAYATRCFQDETSKIFSAQIWETTAYKWVNRRIDKKFTPLIYEAHVGMSSEKPE
VASFNYFRESVLPRIADLGYNTLQIMAIQEHPYYGSFGYQVSSFFAVSSRFGTPEDFKRL
VDAAHGYGIAVIIDLIHSHAVSNVLEGLSQIDGNPALYFHEGARGDHPAWGSKCFNYGKD
EVLHFLLSNCKFWLEEYNLDGFRFDGITSMIYLDHGLGRDFTDYSCYFDGNQDEDALVYL
TLANILIKEINPYAITIAEEMSGIPGLASPFVNGGNGFDFRMSMGVPDHWIKWIKELRDE
DWNMSNIFHELTRKRADEKTVSYSECHDQALVGDKTIIFRLMDKDMYHYMSKDIPNLNVD
RGIALHKMIRLLTLTTAGDGYLNFMGNEFGHPEWIDFPREGNSWSYHYARRQWSLADDKN
LKYHYLLCFDKALIELANEGELFGKPAVSIYEDNDRQILIFSRSGLIMAFNFNPSLSYPD
YSFNLPAGEYEIILNTDAPEFGGFGRIDQEMKYLTKRENGRDSLSVYLPSRSAVILREIY
YL
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggaagagttgaagctgatagaagacgacccctggctggtaccctacagacgtgatatt
ctcagaaggtatcagaaggcggttaccaaacgacaggagttggccggatacggaaaacct
ttatacaagtcggttaactctcacctctattacggagtgcatcgtacaggcaactcctgg
ttcttcagggagtgggctcccggagcaacggctatatacctgattggtacattcaacaac
tggaagatcgagaaaaaatatacccttagctccaaaggaaacggagactgggagttggaa
cttcctgcagagagtgtcagacaaggggatcttttcaagtggtatgtatactggaacggg
ggagagggagaacgaatgcctgcatacgcaaccagatgtttccaggatgaaacaagtaag
attttctctgctcagatttgggaaaccacggcttataaatgggttaaccggcggattgat
aaaaaattcacaccactgatatatgaggctcatgtgggtatgagttctgaaaaacccgaa
gttgcaagttttaattatttccgggagagtgttctgccgcgaattgctgatctgggatac
aatacactacagataatggcaattcaggaacatccctattatggttcattcggataccag
gtatcttctttctttgcggtaagctcacgcttcggtacgcctgaggattttaaaaggctt
gtagatgcagcacacggctacgggatagcggttatcatcgatcttatccattcacatgcc
gttagtaatgtattggagggactctcacagattgacgggaatcccgcactctactttcac
gaaggggccagaggagaccatccggcctggggttcaaagtgtttcaattatgggaaggat
gaggttctgcatttcttgctctcaaattgtaaattctggcttgaagagtacaatctggac
ggattccgttttgacggcatcacaagcatgatatatctcgatcatggtctcggaagggat
ttcacagattactcctgttatttcgacggcaaccaggatgaggatgcgcttgtatacctg
actcttgccaatattctcataaaggagataaacccatatgcaattaccattgcagaggag
atgagcggaatacccggtctggcttctccttttgtaaatggaggtaatggttttgatttc
agaatgagcatgggggtacccgatcactggatcaaatggattaaggagttaagggacgag
gattggaatatgagcaatatatttcatgaactgacaagaaagagggctgacgagaaaacg
gtaagctattcagagtgtcatgatcaggctcttgtcggagacaaaacaatcatattcaga
ttgatggacaaggatatgtatcattatatgagcaaggatatcccaaatctcaatgtagac
agaggaattgccctgcacaaaatgattcgactgctcacacttacgactgccggagacgga
tatctcaattttatgggaaacgagttcggccatccggaatggattgatttcccgagagaa
ggaaactcatggtcatatcactatgccagaaggcagtggtctctggcagatgacaaaaat
ttgaaatatcactatcttctctgttttgacaaggctttaatcgaattggccaatgaggga
gaactttttgggaaaccggctgtttcaatttatgaggacaacgataggcagatattgatc
ttctcgagatcaggtctgataatggcattcaatttcaatccgtcactctcgtatcccgac
tacagtttcaacctgccggctggtgaatatgagataatcctcaatacggatgcccctgaa
tttggaggatttggcaggattgaccaagagatgaagtatctcaccaagagagaaaacggg
agagactctctgtcggtctatcttccgtccagaagtgctgttattttaagggaaatttat
tatctttaa

DBGET integrated database retrieval system