KEGG   Bacteroides sp. CF50: BRDCF_05140Help
Entry
BRDCF_05140       CDS       T02861                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bacc  Bacteroides sp. CF50
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bacc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BRDCF_05140
Enzymes [BR:bacc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BRDCF_05140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1196016..1196690
Genome map
AA seq 224 aa AA seqDB search
MKENSDLPLIIEEFIDVANEMCYYADLLWHKGYVQANGSNITVRVADNLLLATPSRSTKM
SIKPEDLVIVDMNGQHIFGKMTATSELSSHLAIYKVNPDTGAVIHSQPPYTSSYACSENF
PMNLLNPEEVLWIDYMAFAPFTIPGSSEMTYQIETRSKGRFVLVLQNNGLMTWGETLRDA
FWRTDVMENHCKIHNYIQSRGDTPREFTYRQMMMLQEMRQKYFK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacagtgatttgccgctgattattgaggaattcattgatgtagccaatgaa
atgtgttattatgccgatctgctctggcacaaggggtacgtgcaggctaacggcagtaat
attacggtaagggtggcagacaatctcttgctggcaaccccttccagaagcacaaaaatg
agtatcaagccggaagatttggttatagtcgacatgaacgggcaacatatcttcgggaag
atgacagcgacaagtgaactctcttcgcatctggctatctataaagtaaatcccgacaca
ggagccgtgatacattctcagcctccatatacatcttcttatgcatgttctgagaatttc
ccgatgaatcttttaaatcctgaagaggtattatggattgattatatggcttttgcacca
ttcactattccgggttcctctgaaatgacatatcagatagagacaagatcaaagggacgt
tttgttctggttctgcagaacaatggacttatgacatggggagagactctccgggatgca
ttctggcgaacagatgtgatggaaaatcattgtaagatacataattacatacaatcaaga
ggagataccccaagagaatttacctacaggcaaatgatgatgcttcaggagatgaggcaa
aagtattttaaatag

DBGET integrated database retrieval system