KEGG   Bacillus sp. 1NLA3E: B1NLA3E_02505Help
Entry
B1NLA3E_02505     CDS       T02643                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B1NLA3E_02505
Enzymes [BR:baci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B1NLA3E_02505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549567..550487
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLISYIDKMPKEGETLEAPDFEIGCGGKGANQAVAAAKMGSKVMMVTKV
GDDLFADNTIQNLESYGIDTEFTNKVLGTSSGVAPIFVDPESKNRILIIKGANQQLLPVD
VDRAADKLKQCSLIVLQLEIPLETIYRAIEFGNEHGIPVILNPAPASKNLDFSYVCKCDF
FIPNESELEILTGMPVETDEQIKAAASTLIEKGVKDVIVTMGSRGVMWVTKGEVHIVDSH
TVAAIDTTGAGDAFIGCFAHYFVQDGDVLHAIKMATAFAALSVTKRGTQTSYPSFDEVEQ
FMNVMV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcagtaatcggatccaacatggtggatctcatttcatatattgataaaatg
cctaaagaaggggaaacacttgaggcgcctgacttcgaaattggttgtggaggaaaaggt
gcaaaccaggcagtcgcggcggcaaaaatgggctcaaaggtgatgatggttacaaaggtt
ggggatgatctgtttgcggacaacacgattcaaaaccttgaaagctatggaatcgatact
gagtttactaataaagttctaggtacctcaagcggagtcgcgccgatttttgtagatccg
gaatctaaaaaccgcatcctaatcattaagggggcgaatcagcagcttctaccagtggat
gtggaccgggcggcagataagctgaaacaatgttccctgattgtcctacagcttgaaatt
ccgctcgagacgatttaccgggccattgaatttggaaacgagcatggaattcctgttatt
ctaaatccggcacccgcctcaaagaatctagatttcagctatgtgtgcaaatgtgatttt
ttcataccaaatgaaagtgaattagaaatcctgacagggatgccagttgaaacggacgaa
caaatcaaggctgctgcaagcacgttaattgaaaaaggtgtaaaagatgtgattgtaaca
atgggcagccgaggagttatgtgggtgaccaaaggggaagtgcatatcgttgactcgcat
acggtagccgctattgacacaacaggggcgggagatgcttttattggttgctttgcccac
tatttcgtgcaagacggagatgttcttcatgccataaaaatggctactgcttttgcggca
ttaagtgtcacaaaacgtggaacacagacttcttatccaagttttgacgaagtcgagcag
ttcatgaatgtaatggtttga

DBGET integrated database retrieval system