KEGG   Bacillus sp. 1NLA3E: B1NLA3E_04000Help
Entry
B1NLA3E_04000     CDS       T02643                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:baci00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
890946..892361
Genome map
AA seq 471 aa AA seqDB search
MFEEKQKVVIIGGGITGLSTAYYLQKHAADHNLPFEVKLIEATHRLGGKIQTVVKDGYVI
ERGPDSILERKKSVSRLAKEVGIDKELVNNSSGKSFILANESLFPMPGGSIMGIPTELGP
FITTRLFSVMGKMRAAADLLIPRSCAKEDQSLGHFFRRRLGDEVLENLIEPLLSGIYAGD
IDRLSLMSTFPQFYQVEQKHRSLILGMRKSAAAESKNISNSSSKKGMFVTLSTGLQSLIE
ATEAKLLPNSVMKGFRVEAITKVGEVYEIELNSKEKIKADSVVVAVPHLTCASIFSQYEY
FSVFKDVPATSVATVALAFPQDAIKKDIEGMGFVVSRNSDFTITACTWTHKKWPHTTPKG
KVLIRCYVGRPGDETIVDLSDDEIINIVLDDLSKTMDITASPELSVVTRWKDSMPQYTVG
HKARVETVNKHVEEELPGIFLAGSSYKGIGVPDCIDQAEEAVEKVLQYLKK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagaaaagcaaaaggtggtcatcatcggaggcggaataacgggactttcaaca
gcctactatctacaaaagcatgccgctgatcataaccttccttttgaagtgaaactgata
gaggcgacccaccgccttggggggaaaattcagaccgttgtaaaagatgggtatgtgatt
gaaagaggtccagactcgatccttgaacgaaagaaaagcgtttcgcgcctagcaaaggaa
gtgggaattgacaaggaattggttaataattcctcaggcaagtcgtttattttagcgaat
gaaagcttgtttcccatgccaggtggatcgattatgggaataccaacagaactgggtcct
tttattacaacgcggctattttctgtaatgggtaaaatgagagctgccgccgatttgctc
ataccacgatcttgtgcaaaggaagaccagtctcttggacatttctttcgacgtagatta
ggggacgaagtgttagagaatttaattgagccattgttgtcagggatatatgctggtgat
attgaccgtttaagcttaatgtcgacttttccacaattttaccaggttgaacaaaaacat
cgtagcttaatccttgggatgaggaaaagtgcagctgcagagtcaaaaaacataagcaat
tcctctagcaaaaagggaatgtttgtaacgttatcgactggtttgcaatcattaatcgaa
gctactgaagcgaagttacttccaaactctgtcatgaagggatttcgagttgaagccatt
acaaaggttggggaagtatacgagattgagctaaatagcaaagaaaagattaaggctgac
agcgttgtggtagcagttccgcatctcacttgcgcatcaatcttttcacaatatgaatat
ttctcagtatttaaagacgtccctgccacctctgttgcaacagttgcacttgctttccca
caagatgcgatcaaaaaagatatagagggaatggggtttgttgtttctagaaacagtgat
tttaccataacagcctgtacttggacacataaaaaatggccacataccacaccaaaaggc
aaagtactaattcggtgttatgttggtagaccaggcgatgagacaattgtagatttatcg
gatgatgaaattattaatattgttttggacgacctaagtaaaacaatggacatcaccgca
agtccagaattatcagtggttacacgctggaaggattcaatgccccagtacacagttgga
cataaagccagagtagaaacagtcaataaacatgtagaagaagagcttccaggaatattt
ttagcaggtagctcgtataaaggaattggagttcccgattgtattgatcaagctgaagaa
gcagtagaaaaagtactgcaatatttaaaaaaataa

DBGET integrated database retrieval system