KEGG   Bacillus sp. 1NLA3E: B1NLA3E_08430Help
Entry
B1NLA3E_08430     CDS       T02643                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B1NLA3E_08430
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1NLA3E_08430
   00650 Butanoate metabolism
    B1NLA3E_08430
  Amino acid metabolism
   00360 Phenylalanine metabolism
    B1NLA3E_08430
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1NLA3E_08430
   00622 Xylene degradation
    B1NLA3E_08430
   00621 Dioxin degradation
    B1NLA3E_08430
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B1NLA3E_08430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848906..1849790
Genome map
AA seq 294 aa AA seqDB search
MKKIKVGILGSGNIGTDLMYKVERSPYLEMGVMIGIDPDSEGLKRAKARGYKVIDKGIEG
FMEQPELADIIFDATTAYSHIKHNELLRSVNKKIIDLTPAAIGPLVSPPVNLKEHADAQN
VNMITCGGQATIPIVHAISQVTPVSYAEIVATVSSKSVGPGTRINIDEFTQTTAKGIETV
GGAKKGKAIIILNPAEPPVIMRDTVHALVEKMDQEAIMNSIDSMVEKVKEYIPGYRLRGK
PFIEGNRITVFLEVEGAGDFFPPYAGNLDIMTAAGVKIAEEFAKQTYQSKKITN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaaagttggcattttaggatcaggaaatattggaactgatttgatgtat
aaagttgaaagaagcccatatttagaaatgggagtcatgattggcattgatccagattca
gaaggtttaaaacgagcaaaagctagaggctacaaggtgattgataaaggaatcgaagga
tttatggaacagccagaactagctgatattatttttgatgcgacgacagcctattctcat
atcaagcataatgagctgcttcgttcagttaataaaaaaataattgatttgacaccagca
gcaattgggccacttgtttcgccaccagtaaaccttaaggagcatgcagatgcgcagaat
gtaaacatgattacttgtggtggacaagcgacgatcccgattgttcatgccattagtcaa
gtaacacctgttagttatgctgaaattgtcgcaaccgtatcgagcaaaagcgttgggccg
ggcacaagaatcaacattgatgaatttactcagaccacggctaaaggaattgaaacagtt
ggcggtgcaaaaaagggaaaagcaatcatcatcttaaatcccgcagaaccacccgttata
atgagagatactgtccatgcgttagtagagaaaatggatcaagaagcgatcatgaattca
atcgattcaatggttgaaaaggttaaagaatatattccgggttatcgccttcgtggcaaa
ccatttatagaaggaaatcggattacagtatttttggaggttgagggggcaggggacttc
ttcccaccatatgctgggaatttggatatcatgacggcggcaggcgttaaaattgctgag
gaattcgccaaacaaacctaccaatctaaaaaaataacaaattaa

DBGET integrated database retrieval system