KEGG   Bacillus sp. 1NLA3E: B1NLA3E_09900Help
Entry
B1NLA3E_09900     CDS       T02643                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B1NLA3E_09900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B1NLA3E_09900
   00620 Pyruvate metabolism
    B1NLA3E_09900
   00650 Butanoate metabolism
    B1NLA3E_09900
  Lipid metabolism
   00071 Fatty acid degradation
    B1NLA3E_09900
  Amino acid metabolism
   00350 Tyrosine metabolism
    B1NLA3E_09900
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B1NLA3E_09900
   00626 Naphthalene degradation
    B1NLA3E_09900
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B1NLA3E_09900
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B1NLA3E_09900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2169101..2171695
Genome map
AA seq 864 aa AA seqDB search
MAVKEKTLKETQSVEETINRLVENGLKALKEFRQLDQAQVDVIVEKMAVAGLDQHMPLAK
LAVEETGRGVYEDKIIKNIFATEYIYNGIKDNKTVGYINEDKHAGTYTIAEPIGVIAGVT
PITNPTSTTMFKSIITAKTRNPIIFAFHPSAQRCSSEAARVVRDAAIAAGAPEHCIQWIE
APSLEATKLLMNHPKISLILATGGSGMVKSAYSSGKPALGVGPGNVPCYIEKSANIRRAV
NDLILSKTFDNGMICASEQAVIIDKEIYADVKKEMIANDCYFLTEEEKKMVEKLVINENT
CAVNAEIVGRPAPEIARLAGVIVPESVKILVAELKGVGANYPLSREKLSPVLACYKVNSL
EEGLTRAEEMLAFGGLGHSAVLHSNDDEVIKQFGYRMQAGRIILNAPSSQGAIGDIYNAY
IPSLTLGCGSYGGNSVSTNVGTVHLVNTKMMAKRNTNMQWFKIPPKLFFYKHSTQYLAKM
EGISRAIIVTDPGMVKLGYVDTILHYLKQRTNQVAVEIFSEVEPDPSLDTVVKGVEKMIN
FQPDVIIALGGGSAMDAAKGMHLFYEHPEVDFFGIKQKFLDIRKRVVKFPKSGTKTKFVA
IPTTSGTGSEVTSFSVITDKKVGMKYPLADYELTPDVAIIDPQFVMTVPKAITADTGMDV
LTHAIEAYVSVFANDYTDGLAMKAIQLVFEYLPKAYHNGSDELAREKMHNASTIAGMAFT
NAFLGINHSLAHKLGSEFHIPHGRANTIVLPHVIRYNASKPTKFVGFPHYERFIAHERYA
EIARMLGLPASTTQEGVESLVQAIIKMTKEFGMPTTLEAAGVDKKEFDQKVDWLAERAFE
DQCTTANPRYPLVTELAGIYRKAF
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagaaaaaacgttaaaagaaactcaatcagtagaagaaactattaatcgc
cttgtcgaaaatggactaaaagcattaaaggaatttagacaactggatcaagcgcaagtt
gatgtaattgtggaaaaaatggcagttgcgggattagatcagcatatgcctcttgcaaaa
ctcgcagttgaagaaacaggtcgaggcgtatacgaagacaagattatcaaaaatattttt
gcaactgaatacatatataacggtattaaagataacaaaacagttggatatatcaacgaa
gataaacatgcaggtacctatacaatagctgaacctatcggggtcattgcaggagttact
ccaatcacgaatcctacatcgaccacaatgttcaaatcaattattactgcgaaaacgcga
aatcctattatttttgctttccatccatctgctcaaagatgtagcagtgaggcagcaaga
gtagtacgtgatgccgctatcgctgcaggcgctcccgaacattgcattcaatggatcgaa
gctccatctttagaagcaaccaaactattaatgaaccatccaaaaatttcacttatttta
gcaactggtggctctggtatggttaaatcagcgtatagctctggtaaaccagcacttggt
gttggaccaggtaacgtaccgtgttatattgaaaaatctgctaacatcagacgagcagta
aatgatttaattttatcaaaaacatttgataatggaatgatttgtgcatctgagcaagcg
gtaatcattgataaagagatctatgcggatgtaaaaaaagaaatgattgctaacgattgt
tactttttaactgaagaagaaaagaaaatggtagaaaagcttgttattaatgaaaacaca
tgtgctgtaaatgccgaaatagttggaagacctgcacctgaaattgcccgtctagctggg
gtgattgttcctgaatcagtaaagatattagttgctgaattaaagggagttggagcaaat
tatccgctatcacgtgaaaagttaagcccagttctagcttgttataaagtgaacagttta
gaggaagggttgacaagagcggaagaaatgctagcatttggtggtttaggacattcagct
gttcttcatagcaatgatgatgaagtaataaaacagtttggatatagaatgcaagcaggc
cgtattattctgaatgctccatcatcgcaaggagcaatcggggatatttataatgcatac
attccatcgctaactcttggttgtggatcctatggtggaaactctgtttctacaaacgtt
ggaaccgttcatttggttaatacaaaaatgatggcaaagagaaatacgaatatgcaatgg
tttaaaattccaccaaaattgtttttctataaacacagcacacagtatttggcgaaaatg
gaaggtatctcaagggctataattgtaacggatccaggtatggtgaaattagggtatgtc
gatacaattcttcattacctgaaacaacgtactaaccaggtagctgtagaaattttctct
gaagtagagccggatccatcgctcgacactgttgtaaaaggtgtagaaaagatgataaac
ttccagccagatgttattatcgcacttggcggcggctctgcaatggatgctgcgaaagga
atgcacttattctatgagcatccagaggtcgatttctttggtattaaacagaagttcctg
gatattcgaaaaagagttgtaaagtttccgaaatctggtacaaaaacaaaatttgttgcg
atccctactacatctggaactgggtcagaggtaacatctttctctgttatcactgacaaa
aaagtaggcatgaagtatccgctggctgattacgagttaacaccagatgtagcgatcatt
gacccgcaatttgttatgacagtaccgaaggcaatcactgctgatacagggatggatgta
ctcacccatgcgattgaagcttatgtttcagtgttcgcaaatgactacactgacggatta
gcaatgaaagcaatccaactagtgttcgaatatcttccaaaagcataccataatggaagt
gatgaattagctcgtgaaaaaatgcataatgcatctacaatcgcaggaatggcgtttacg
aatgcattcttgggtatcaatcacagcttagcacacaagcttggctctgaattccatatt
ccacatggacgtgctaatacgatcgtgttgccacatgtaattcgctataatgcttcgaaa
ccaacaaaatttgttggattcccacattatgaaagatttatcgctcatgaaagatatgct
gaaattgctagaatgcttggcttaccagctagcacaactcaagaaggcgttgaaagccta
gtccaagccattattaaaatgacaaaggaatttggaatgccgactactcttgaagcagcc
ggagttgacaaaaaagagtttgaccagaaagtagactggttagcagaacgtgcatttgag
gaccaatgtactactgcaaatcctagatatccacttgtaactgaactagctggtatctac
cgtaaagcgttttaa

DBGET integrated database retrieval system