KEGG   Bacillus sp. 1NLA3E: B1NLA3E_10295Help
Entry
B1NLA3E_10295     CDS       T02643                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B1NLA3E_10295
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B1NLA3E_10295
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    B1NLA3E_10295
Enzymes [BR:baci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     B1NLA3E_10295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2254088..2255179
Genome map
AA seq 363 aa AA seqDB search
MEKKRVVVKIGSSSLTNSKGEIDYEKFIDHIQAIAAMREAGHEIVLVSSGAVAAGFARLG
YPSRPVTLKGKQAAAAVGQSLLIQSYMEQLGKYNIIPAQILITRNDFSKKDRYRNAYSTI
TELLERGILPIINENDTVSVEELTFGDNDMLSALVSGLVHAEQVIILTDINGLYNANPRK
NPDAKRFNYLEEVTDDMLSVADSTGSNVGTGGMLSKLIAAKTALSLGVRIFIGNGKGRNK
LLEILEGEGDGTYIGARDLTAVTNNKQWIALHSEVSGQIFVDKGAEDALLLQGGSLLPAG
IYDVNGSFEKGEVVEVFGTTGLLGKGEVLYSSEQLMKIMGKRTDELTSVVKMAVIHRDKW
VQA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaagcgggttgtagtcaaaattgggagtagttctttaacaaattcaaaaggt
gaaattgattatgaaaaattcattgatcatattcaggcaattgccgcaatgcgtgaagcg
ggccatgaaattgttttagtttcatctggtgcagtggcagctggttttgcacgacttggc
tatccttccagaccagtaactttaaaagggaaacaggctgctgctgctgttggccaaagc
ttgctcatccagtcctatatggaacagttaggcaaatataatattatccctgctcaaatt
ttaataactcggaatgacttttctaaaaaggatcgctaccgaaatgcttattcgacgatt
acagagttattagaaagaggaattctgccaataatcaatgaaaatgatacagtttcggtt
gaagagttgacctttggtgataatgacatgctttcggcattggtaagtgggttagttcat
gccgagcaagtgattattctaaccgacataaatggactctacaatgccaaccctcgaaaa
aatcctgatgctaaaagatttaattatctcgaggaagtgacggacgacatgctttctgtc
gctgatagtacaggttcaaatgttggaactggggggatgctttcaaagctaattgcagct
aaaactgctctttccttaggtgttcgcatttttatcgggaatgggaaagggagaaacaaa
ttactggaaattttggagggggaaggtgacggaacctatattggtgctcgtgacctgact
gctgttacaaataacaagcaatggattgcacttcattccgaggtatctggccaaattttt
gtggataaaggtgcagaggatgctctgctgttacagggtgggagcctattgcctgccggg
atatacgatgttaacggttcatttgaaaaaggtgaagtagtagaagtgtttggtacgact
gggctgctgggtaagggggaggttctatactcttctgaacaattaatgaagattatggga
aaaagaacagacgaattgactagtgtggtaaagatggctgttattcacagagataaatgg
gttcaagcataa

DBGET integrated database retrieval system