KEGG   Bacillus sp. 1NLA3E: B1NLA3E_10295Help
Entry
B1NLA3E_10295     CDS       T02643                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baci01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:baci00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2254088..2255179
Genome map
AA seq 363 aa AA seqDB search
MEKKRVVVKIGSSSLTNSKGEIDYEKFIDHIQAIAAMREAGHEIVLVSSGAVAAGFARLG
YPSRPVTLKGKQAAAAVGQSLLIQSYMEQLGKYNIIPAQILITRNDFSKKDRYRNAYSTI
TELLERGILPIINENDTVSVEELTFGDNDMLSALVSGLVHAEQVIILTDINGLYNANPRK
NPDAKRFNYLEEVTDDMLSVADSTGSNVGTGGMLSKLIAAKTALSLGVRIFIGNGKGRNK
LLEILEGEGDGTYIGARDLTAVTNNKQWIALHSEVSGQIFVDKGAEDALLLQGGSLLPAG
IYDVNGSFEKGEVVEVFGTTGLLGKGEVLYSSEQLMKIMGKRTDELTSVVKMAVIHRDKW
VQA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaagcgggttgtagtcaaaattgggagtagttctttaacaaattcaaaaggt
gaaattgattatgaaaaattcattgatcatattcaggcaattgccgcaatgcgtgaagcg
ggccatgaaattgttttagtttcatctggtgcagtggcagctggttttgcacgacttggc
tatccttccagaccagtaactttaaaagggaaacaggctgctgctgctgttggccaaagc
ttgctcatccagtcctatatggaacagttaggcaaatataatattatccctgctcaaatt
ttaataactcggaatgacttttctaaaaaggatcgctaccgaaatgcttattcgacgatt
acagagttattagaaagaggaattctgccaataatcaatgaaaatgatacagtttcggtt
gaagagttgacctttggtgataatgacatgctttcggcattggtaagtgggttagttcat
gccgagcaagtgattattctaaccgacataaatggactctacaatgccaaccctcgaaaa
aatcctgatgctaaaagatttaattatctcgaggaagtgacggacgacatgctttctgtc
gctgatagtacaggttcaaatgttggaactggggggatgctttcaaagctaattgcagct
aaaactgctctttccttaggtgttcgcatttttatcgggaatgggaaagggagaaacaaa
ttactggaaattttggagggggaaggtgacggaacctatattggtgctcgtgacctgact
gctgttacaaataacaagcaatggattgcacttcattccgaggtatctggccaaattttt
gtggataaaggtgcagaggatgctctgctgttacagggtgggagcctattgcctgccggg
atatacgatgttaacggttcatttgaaaaaggtgaagtagtagaagtgtttggtacgact
gggctgctgggtaagggggaggttctatactcttctgaacaattaatgaagattatggga
aaaagaacagacgaattgactagtgtggtaaagatggctgttattcacagagataaatgg
gttcaagcataa

DBGET integrated database retrieval system