KEGG   Bacillus sp. 1NLA3E: B1NLA3E_13055Help
Entry
B1NLA3E_13055     CDS       T02643                                 

Gene name
ligD
Definition
(RefSeq) ATP-dependent DNA ligase (EC:6.5.1.1)
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:baci00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    B1NLA3E_13055 (ligD)
Enzymes [BR:baci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B1NLA3E_13055 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2876741..2878609
Genome map
AA seq 622 aa AA seqDB search
MILFQQKRKVKLMKPMLPSLTFNIPEGVDWYYEVKYDGFRAILEWNVNNLTLTSRNGKPL
LALFPEIELFLLRNKEKFAPFLPLALDGELVFLENPYKADFGSIQVRGRMRSQKKILEKA
ELQPCFLLVFDVLHLQGVALKGKPYIKRKGELTKLFTAVDLPLVPSENNSKLVQMIPSKQ
NFQSVWDNVVLYDGEGIVAKQELNLWEDGKRSISWLKYKNWKYVSCFITAYDKSNGYFYI
GVFKGGVVYPIGLFLFGLTPEEKQALVRIIKDNQIREDAQFVYVPPAICVEVKYLEVYEK
QLREPHFHQFRFDLKAEDCIIENFIYNQKNLPLDIEITHPEKPIWETPPVTKIDYIHYLQ
EVSPYILPFLKDRALTVIRHPHGMFGEPFYQKNRPDYAPDYVHSFHRENIDYIVCNNFKT
LLWLGNQLAIEFHIPFQTINNAFPSEIVLDLDPPSKKDFHLAIKAALLIKEVLDHLNLIS
FVKTSGNKGLQIYLPLQENQVSYDDTRLFTAFIAEYLVSKDPDSFTIERMKKNRGNRLYV
DYVQHGEGKTIIAPYSLRGTGPATVATPLYWHEVTDKLTAETFNITNMVERIRKVGDPFQ
TYFEAKKIQNIKPILEFLAKKR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
ttgattctgtttcagcaaaaaaggaaggtaaaattaatgaaaccaatgttgccaagtcta
actttcaacattcctgaaggtgttgattggtattatgaagtgaaatatgacggctttagg
gctattttagaatggaatgtaaataacctaacgcttacaagcagaaatggaaaacctctc
cttgcgcttttccctgaaattgaactttttttattaagaaataaagaaaaattcgctcct
tttcttccacttgcattagatggagagctcgttttcttggaaaatccttataaagcagat
tttggctcaattcaagtacgaggtagaatgcgctctcaaaaaaaaatccttgagaaagct
gaattacaaccatgttttttattggtgtttgatgtattgcacttgcaaggtgttgcatta
aaagggaaaccatacataaagaggaaaggtgagttaactaaactgtttacagcggtagac
ttaccacttgtgccaagcgaaaataactcaaagcttgtgcagatgattccctcgaaacaa
aactttcaatcggtttgggataatgtggtcctttatgacggggaaggcatcgtggcaaaa
caggaactgaatctctgggaagacgggaaacggtcaatctcttggttgaaatacaaaaat
tggaaatatgtttcatgttttataaccgcatatgataaatcgaatggctatttttatatt
ggggtttttaaaggtggcgtggtttacccaattggccttttcctttttggccttacacct
gaagagaaacaagcgcttgtccgaattatcaaggacaatcagattcgcgaagatgctcaa
tttgtatacgtgccgcctgcaatttgtgtggaggttaaatatttagaagtatatgaaaaa
cagcttagagagccacactttcatcaattccgatttgatttgaaggctgaagattgtatt
attgaaaactttatatataatcaaaaaaacttaccactagacattgaaatcacccatcct
gagaaaccaatttgggagacaccgcccgtaacaaaaatagattatattcattatttacag
gaagtttctccttatatactcccctttttaaaggacagagccttaactgtcattcgtcat
ccccatggtatgtttggcgagcctttttatcaaaaaaatcgaccggattatgcaccagat
tatgtgcattcttttcatagggaaaatattgactatattgtttgcaacaactttaagacg
ttgctttggcttggtaatcaacttgcaatcgaatttcatattccttttcaaactattaat
aacgcttttccaagtgaaattgtccttgatttggatcctccttcaaaaaaagattttcat
ttagctataaaggctgctttattaataaaagaggttcttgatcacttaaaccttattagt
ttcgttaaaacctcgggcaacaaagggttacaaatttatttgccgctccaagagaatcaa
gttagttatgatgatacaagattgtttactgcttttattgctgaatatttagtatcaaaa
gatccggattcttttacaattgaaagaatgaagaaaaaccgtggcaatagactttatgtt
gattatgttcaacatggagaaggaaaaacgataatcgctccttattctttaagagggaca
gggccggcaactgtagcgaccccgctttattggcatgaagtgaccgacaagcttacagca
gaaacctttaacatcactaacatggtagagcggattaggaaagttggagacccttttcaa
acctattttgaagcaaaaaaaatccaaaacattaaacccattctagagttcttagcaaaa
aagagataa

DBGET integrated database retrieval system