KEGG   Bacillus sp. 1NLA3E: B1NLA3E_19080Help
Entry
B1NLA3E_19080     CDS       T02643                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    B1NLA3E_19080
  Lipid metabolism
   00561 Glycerolipid metabolism
    B1NLA3E_19080
   00600 Sphingolipid metabolism
    B1NLA3E_19080
Enzymes [BR:baci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     B1NLA3E_19080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4113984..4116173)
Genome map
AA seq 729 aa AA seqDB search
MPIDWNDKDGIFHLYNKNISYLLQIVHGKYLAHLYWGKRVQIHQPTSILLFKGRTFSPTT
EAGELQFSLDTLPQEYPAYGNGDFRSPAYQIRSADGSTITEFVYDSFEIFQGKRPLNGLP
AAYVEDKSEAETLVVTMVDSMLGIGIDLHYTIFHDLDVITRSVSYENLGSEAVEIQKCMS
ASIDFHQANWDWLQLSGTWARERHIDRIPVHPGIQMISSARGASSHQHNPFIAILSKDTT
EEFGDVYGLSLVYSGNFQAYIETGSYHTARVSIGLNSFDFAWLLKSGETFQTPEALMVYS
SEGLGGMSRTFHKLLRTRVCRGVYRDKTRPILINNWEATYFNFNEKRLKNIADAGKELGI
ELFVLDDGWFGHRNNAKSSLGDWDVDTKKLPNGLDGLADYICKRGMKFGLWVEPEMVSPD
SDLYRKHPDWCIHVPGRNRTLSRNQLILDLSREDVVDFLIETLTKVLNSAKISYVKWDMN
RNMTEIGSAKLPPERQKETAHRYMLGLYRILETLIDRFPDILFESCSGGGGRFDPGMLYY
MSQTWTSDDTDAVERLKIQYGTSMVYPAITMGAHVSDVPNHQVGRTTPLLMRCHVAMAAN
LGFELNIDKMSSDDKKMIMKQIKQYDQIRDIICFGDLYRLLSPFAGMDTALMYVSENQEK
AVVFNFKTLATPNPPFLRVKLRGLKPNDLYRVNHADKKYFGDELMTIGLTLPLIKEDFSS
YIYQIEKAD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcgattggaatgacaaagatgggatttttcatctttataataaaaacattagt
tatctgcttcagattgtccatggtaaatatctagcgcatttgtactggggcaaacgagta
cagattcatcaaccgacttcaatactattatttaaaggaaggacgttttcaccgactact
gaagctggcgaattacaattttcccttgatacacttccccaggagtacccggcgtatggg
aacggggattttcgttctcctgcctatcaaatccgttccgcagatggatcgacgataaca
gaatttgtctatgattcttttgaaatttttcaagggaagcgcccccttaatggattacct
gctgcctatgtggaagataaatctgaagctgaaacattggtcgtaacaatggttgattcg
atgcttggaatcgggatcgatttacattacacaatctttcatgatctggatgtcataacg
agatccgtttcctatgagaaccttggtagcgaagctgttgaaatccaaaagtgtatgagt
gcctctattgattttcaccaagcgaattgggattggctacagttgagtggaacatgggcc
agggagcgtcatatcgataggatacctgtacaccctggcattcaaatgatttcatcagcg
agaggggcaagcagtcaccaacataacccttttattgccatcctctcaaaagatacaacc
gaagaattcggtgatgtatacggattaagtctagtgtacagtgggaatttccaagcttat
attgaaacaggctcctatcatactgccagagtaagcatcggcttaaactcctttgatttc
gcttggctcttgaagtcaggggaaacttttcaaacacctgaggctctaatggtctattct
tctgaaggccttggtgggatgtctagaacttttcacaaattattgcgaaccagagtttgc
cgtggtgtttatcgtgataaaacacgtccaattctgatcaataactgggaagctacctat
tttaattttaatgaaaaaagattaaaaaatattgctgatgctggaaaagaactaggtatt
gagttgtttgtcctggatgacggctggttcggacatcgcaacaatgcaaaaagttcgtta
ggtgattgggatgttgatacgaaaaagctgccaaatgggttagatggattagctgattat
atctgtaaaaggggcatgaaatttggcttatgggtggagccggaaatggtttccccggat
agtgatttataccgaaagcatcccgattggtgtattcatgtgcctggaaggaaccgtaca
ttgtctagaaaccaattgatccttgatttaagtcgggaagatgtagtagatttcttaatc
gaaactctaactaaagttttaaatagtgcaaagatttcctatgtaaaatgggacatgaac
cgtaatatgactgaaattggctctgccaaattaccacccgagaggcaaaaggaaacagca
catcggtatatgctgggattgtatcggattctggaaacgctgatagatcgttttccagat
attttgtttgaaagttgttccggaggtggcggtcgcttcgatcccggcatgctgtattat
atgtcgcaaacctggacgagtgatgatacagacgcagtcgaaagattaaaaattcaatac
ggaacaagcatggtttatccagccattacaatgggagcccatgtttcagatgtgcctaat
caccaggtaggaagaacgacgcctttgctcatgcgctgccatgtggcgatggccgcaaat
ttgggttttgaattaaatatcgataagatgagtagtgatgataaaaaaatgatcatgaag
caaatcaagcaatatgaccaaattagagacataatctgttttggggacctttacagactg
ttaagtccgtttgctggaatggacacagccttgatgtatgtttcagagaatcaagaaaag
gcagttgtttttaactttaaaacactggcaactccgaacccaccatttttgcgcgtaaag
ttacggggactgaagcctaatgatctttacagagtgaaccatgctgataagaaatacttt
ggtgatgaactcatgacgattgggctaacgcttccactgataaaagaagacttttcctcc
tatatctatcagatcgaaaaggcagattaa

DBGET integrated database retrieval system