KEGG   Bacillus sp. 1NLA3E: B1NLA3E_19435Help
Entry
B1NLA3E_19435     CDS       T02643                                 

Definition
monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Brite
Enzymes [BR:baci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     B1NLA3E_19435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4189883..4190635
Genome map
AA seq 250 aa AA seqDB search
MNEVKSKVIAGAEPFLFIGNGVGILLSHGFLGTPQSVRELGKLLNKFGFTVYAPRLSGHG
TSIYDIEEAKYSDWLKDLEAGYLKLKETCHDVFIVGQSMGGALCLQLAAKFPDIKGVLTI
NAALHVPAYDQYRNGNGPRFVAEGAPDIKDPQAFEITYDSVPISAIHELQKVIEATADQL
KNVHTPILVFTSKLDHVVPPSDSRKILQDISSKFKQQIVLENSFHVASLDFDKGFIAKSC
YEFIKKFTNN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtaaaaagtaaagtgattgctggcgctgaaccatttttatttataggaaat
ggggtaggaatcctcctgtcccatggatttctcggaacaccccaaagtgtccgtgagctt
gggaaattgttaaataaattcggttttacggtgtatgcacctcggttatctggtcatggg
acatcaatttatgatattgaagaggctaaatattcggactggctgaaggatcttgaggca
ggttatcttaaacttaaagaaacttgtcatgatgtctttattgttgggcagtcaatgggt
ggcgcgctctgcttacaactggccgccaagttcccggatattaagggtgtcctaacgatt
aacgcggcgcttcatgtccctgcttatgatcaatatcgaaatggcaatggtccgcgcttt
gtcgccgaaggtgctccagatatcaaggatccacaggcctttgaaatcacctacgattct
gtcccgatatctgcgattcatgagttgcaaaaagtgattgaagcaactgccgaccaactt
aagaatgttcacacccctatccttgtctttacatcaaaattagatcatgtcgtaccgcca
tctgattcacgaaaaattttgcaagatatttcatcaaagtttaagcaacaaattgtgttg
gaaaattcgtttcatgttgcttcgcttgatttcgataaaggcttcatcgccaagtcttgt
tatgaatttattaaaaaatttactaataattaa

DBGET integrated database retrieval system