KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997899Help
Entry
102997899         CDS       T03086                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    102997899 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102997899 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102997899 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102997899 (SCD5)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102997899 (SCD5)
Lipid biosynthesis proteins [BR:bacu01004]
 Desaturase
  First
   102997899 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 308 aa AA seqDB search
MLCASCPLVGAPLHTCPPARGLDIKDSSVEGLASSSHHQREPPGEECKRPEFTQKAYFCF
LLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQNDIFEWSRDHRVHHKYSETDA
DPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRFQRKYYKITVVLMCFM
VPTLVPWCIWGESLWNSYFLASILRYTISLNVTWLVNSVAHMYGNRPYDKNISPRQNPLV
TLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDFMCWLGLATDRKRATKPMIEARK
ARTGEGSA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtgcttcatgtcctctggtcggagcccccctgcacacctgcccgccagcccgg
ggcttggatatcaaagactcctctgtggagggcctggcgagcagctctcaccatcaaagg
gagccgccaggagaagagtgcaaacggcccgagttcacacaaaaggcctacttctgcttc
ctcctgactgctctgggtgtgacagctggtgcccatcgcttgtggagccacaggtcctac
aaggccaagctgcctctgaggatatttctggccgctgccaactccatggctttccagaat
gacatcttcgagtggtccagggaccaccgagtccaccacaagtactcggagaccgacgct
gatccccacaacgcccgccggggcttcttcttctcccatatcgggtggctgtttgtccgc
aagcatcgggatgttatcgagaaggggaggaagcttgacgtcaccgacctgctggctgat
cctgtggtccggttccagagaaagtactacaagatcaccgtggtgctcatgtgcttcatg
gtccccacgctggtgccctggtgcatctggggagagagtctgtggaattcctacttcctg
gcctccatcctccgctacaccatctcactcaatgtcacctggctggtcaacagtgtcgcc
cacatgtacggaaaccggccctatgacaagaacatcagccctcggcagaacccgctcgtc
accctgggtgccatcggtgaaggcttccataactaccatcacacctttccctttgactac
tctgcgagtgaatttggcttaaatttcaacccaaccacctggttcattgacttcatgtgt
tggctggggctggccactgaccgcaaacgggcaaccaagccgatgattgaagcccggaaa
gccagaactggagagggcagcgcctga

DBGET integrated database retrieval system