KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999195Help
Entry
102999195         CDS       T03086                                 

Gene name
PTGS2
Definition
prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Orthology
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Leishmaniasis
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102999195 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102999195 (PTGS2)
   04064 NF-kappa B signaling pathway
    102999195 (PTGS2)
   04668 TNF signaling pathway
    102999195 (PTGS2)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    102999195 (PTGS2)
   04921 Oxytocin signaling pathway
    102999195 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    102999195 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102999195 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102999195 (PTGS2)
   05206 MicroRNAs in cancer
    102999195 (PTGS2)
   05204 Chemical carcinogenesis
    102999195 (PTGS2)
   05222 Small cell lung cancer
    102999195 (PTGS2)
  Infectious diseases
   05140 Leishmaniasis
    102999195 (PTGS2)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102999195 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
MLVRVLLFCAALALCGAANPCCSSPCQNRGVCMSIGFDKYKCDCTRTGFYGENCTTPEFL
TRIKLFLKPTPNTVHYILTHFKGLWNIVNNIPFLQNMIMRYVLISRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRVLPPVPDDCPTPMGVKGRKELPDSKEVVEKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTTGQSHGVDLNHVYGESLERQHKLRLFKDGKMKY
QIIGGEMYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKHEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHALLPDTFQIDGQHYNYQQFIYNNSLLLEHGLTQFVESFTRQIAGRV
AGGRNLPVAVEKVSKASIDHSREMKYQSFNEYRKRFLLKPYKSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIITTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtccgcgtgctgctgttctgcgccgccctggcgctctgcggtgcagcaaaccct
tgctgctccagtccatgccagaatcgaggtgtatgtatgagcataggatttgacaagtat
aaatgtgactgtacccgaacaggattctatggtgaaaactgtaccacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaacacagtgcactacatacttacgcac
ttcaagggactctggaacattgtcaataacattcccttcctgcagaatatgattatgaga
tacgtgttgatatcgagatcacatctgattgagagcccgccaacttataatgtgcactac
agctataaaagctgggaagccttttctaacctgtcctattacaccagagttcttcctcct
gtgcctgatgactgcccaacgcccatgggtgtgaaagggaggaaagagcttcctgattca
aaagaagttgtggaaaaagtacttctaagaagaaagttcatccctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggaccagctttcaccacgggacagagccatggggtggacttaaatcatgtttat
ggtgaatctttggagagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattggtggcgagatgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccccctcatgttcctgaacacctgcggtttgctgtggggcaggaagtctttggtcta
gtgcctggtctgatgatgtacgccacaatttggctgcgggaacataacagagtgtgtgat
gtgcttaaacatgagcatccagaatgggacgatgagcagctgtttcagacgagtaggctg
atactgataggagaaactattaagattgtgattgaagactatgtacagcacctgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatgcccttctgcctgacacc
tttcagattgatggccaacactacaactatcagcaatttatctataacaactccctccta
ctggaacacggcctcactcagtttgttgaatcattcactaggcaaattgctggcagggtt
gctggtggcaggaatcttccagttgcagtagagaaagtatcaaaggcttcaattgaccac
agcagagagatgaaataccagtcttttaatgagtaccgcaaacgctttctgctgaagcct
tataaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcgctc
tatggtgacattgacgccatggagctgtaccctgctcttctggtagaaaaacctcgaccg
gacgccatctttggggagaccatggtagaagttggggcaccattctccttgaaaggactt
atgggtaatcctatatgttctcctgagtactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaccactgcctcaattcagtctctcatctgcaataacgtgaaaggc
tgtccttttacctcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcccactctggactagatgatatcaaccccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system