KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003952Help
Entry
103003952         CDS       T03086                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103003952 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    103003952 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103003952 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    103003952 (PTGS1)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103003952 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 622 aa AA seqDB search
MSRRSVSLRFPLLLLLLSPSPVLPADPGAPAPAPVEKISLGEEPVYTSHSRDSGVNPCCY
YPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPELWTWLRTTLRPSPSFLHFLLPHGRW
FWELVNATYIRDMLMRLVLTARSNLIPSPPTYNVAHDYISWESFSNVSYYTRVLPSVPRD
CPMPMGTKGKKQLPDAELLSRRFLLRRKFIPDPQGSNLMFAFFAQHFTHQFFKTSGKMGP
GFTKALGHGVDLGHIYGDNLERQYHLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMRYPQG
IPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILMG
ETIKIVIEEYVQQLSGYFLKLKFDPELLLGTQFQYRNRIAMEFNQLYHWHPLMPDSFRVG
PQNYSYKQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNTDHRVLYVAVEVIKESREL
RLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCPPNSIF
GESMIEIGAPFSLKGLLGNPICSPEYWKSSTFGGEMGFNLVKTATLRKLVCLNTKTCPYV
SFHVPDPRQEDGPGGERPSTEL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcggagtgtctcgctccggttcccgctgcttctgctgctgctgtcgccatcc
cctgtcctgccagcggaccccggggcacccgcgccggccccagtggagaagatctccctc
ggtgaggaacccgtgtacaccagccattccagagacagtggagtgaacccctgttgttac
tatccatgccagcaccagggtatctgtgtccgcttcggccttgaccgctaccagtgtgac
tgcacccgcacgggctattccggccccaactgcaccatccctgagctatggacctggctc
cggactactttgcggcccagcccctctttcctccacttcctgctgccgcatggccgctgg
ttctgggagttagtcaatgccacctacatccgggacatgctcatgcgtctggtactcaca
gcacgttccaacctcatccccagcccccccacctacaatgtagcgcatgactacatcagc
tgggagtccttctccaatgtgagctactatacacgtgttctgccctctgtgccccgagac
tgtcccatgcccatggggaccaaagggaagaagcagttgccagatgccgagctcctgagc
cgtcgcttcctgctcaggaggaagttcatccctgacccccaaggcagcaacctcatgttt
gccttctttgcgcaacacttcacacatcagttcttcaaaacttctggcaagatgggtcct
ggcttcaccaaggctttgggccatggggtcgaccttggccacatttatggagacaatctg
gaacgtcagtatcacctgcggctctttaaggatgggaaactcaagtaccaggtgctggac
ggagagatgtacccgccatcggtggaagaggcgcccgtgctgatgcgctacccccagggc
atcccgccccagagccagatggcagtgggccaggaggtgttcgggctgcttccggggctc
atgctctacgccacactctggttgcgtgagcacaaccgagtgtgtgacctgctgaaggct
gagcacccgacctggggcgatgagcagctcttccagacagcccgcctcatcctcatgggg
gagaccatcaagattgtgatcgaggagtacgtgcagcagctgagtggctacttcctgaag
ctcaagtttgacccggagctgctgttaggcacccagttccagtaccgtaaccgaattgcc
atggagttcaaccagctctaccactggcacccactcatgcccgactccttccgggtgggc
ccccagaactacagctacaagcagttcctgttcaacacctccatgctggtggactacggg
gtcgaggccctggtggacgccttctctcgccagcccgcaggccggatcggcgggggtagg
aacacggaccaccgtgtcctatacgtggctgtggaagtcatcaaggaatcgagagagttg
cgcctgcagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttc
caggagctcacaggagagaaggagatggcagctgagttggaggagctgtatggagacatc
gatgccttggagttctacccagggctgcttcttgagaagtgccctccaaactccatcttt
ggggagagtatgatagaaattggggctcctttttcccttaagggcctcttagggaatcct
atctgttctccagagtactggaagtcgagcacatttggcggtgagatgggtttcaacctt
gtcaagacggccacgctgaggaagctggtttgcctcaacaccaagacttgtccctatgtc
tccttccacgtgccggacccccgccaggaggacgggcctggaggggagcggccatccaca
gagctctga

DBGET integrated database retrieval system