KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005044Help
Entry
103005044         CDS       T03086                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 2-like
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    103005044
 Human Diseases
  Cancers
   05215 Prostate cancer
    103005044
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     103005044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 254 aa AA seqDB search
MSVRCQESPVLAGSATLAALGALVLCLAEPAGYGKYTESRMPVATRLSARAAWFLQELPS
FAVPAGILAGQPRSLFGQPATVLLGLFCAHYFHRTFVYSLLTRGRPFPVVFLFRGFVFCM
GNGLLQGYYLVYCAEYPAEWYTDIRFSVGVFLFILGMGINIHSDYILRQLRKPGEIIYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPVIF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgctgccaggagagtccggtgctggcaggcagcgccactttggccgccctg
ggggcactggttctgtgcctcgcggagcccgccggctacgggaagtacacggagagccgg
atgcccgtggctacccgcctgtccgcccgcgccgcctggttcctgcaggagctgccctcc
ttcgcggtgcccgcggggatcctcgccgggcagccccgctctctcttcggccagcctgcg
actgtgcttctgggcctcttctgcgcacattacttccacaggacatttgtttactcactg
ctcactagagggaggccgtttccagttgtattccttttcagaggctttgtcttctgcatg
ggaaatggactcctccaaggctactatctggtttactgtgctgaataccctgctgagtgg
tacacagacatacggtttagcgtgggtgtcttcttatttattttgggaatgggaatcaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcatctataggatt
ccacaaggtggcttgttcacatacgtttctggagccaatttccttggcgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcatttgcatttttctca
ctttgtttccttgggctgagagcttttcaccaccatagattctacctcaagatgtttgag
gactaccccaagtctcggaaagccctcattccagtcatcttttaa

DBGET integrated database retrieval system