KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006855Help
Entry
103006855         CDS       T03086                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103006855 (ALPL)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     103006855 (ALPL)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103006855 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 524 aa AA seqDB search
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQQTLKNALRLQTLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHSPGEETRLEMDKFPYVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATQRTECNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNVRDIEVIMGGGRKYMFPKNRTDVEYEMDE
KARGTRLDGLNLIDIWKSFKPKHKHSHYIWNRTELLALDPYTVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVEMAIKILNKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGTMTSVEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHDNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYAACIGANRDHCASTSLSGSPSPGPLLFLLALLPLGILF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaccattcttagtgctggccattggcacctgccttaccaactccttagtgcca
gagaaagagaaagaccccaagtactggagagaccaagctcagcagaccctgaaaaatgcc
ctgaggcttcagactctcaacaccaacgtggctaagaatgtcatcatgttcctaggagac
gggatgggcgtctccacggtgacggcggcccgcatcctcaagggtcagctccatcacagc
ccgggagaggagaccaggctggagatggacaagtttccctacgtggccctctccaagaca
tacaacaccaacgctcaggtccctgacagcgcgggcaccgccaccgcctatttgtgcggg
gtgaaggccaacgagggcaccgtgggagtgagcgcagcgacccagcgcaccgagtgcaac
accactcagggcaacgaggtcacctccatcctgcgctgggccaaggacgcagggaaatcc
gtgggcatcgtgaccaccacacgagtgaaccacgccacccccagcgccgcctatgcccac
tctgctgaccgggactggtactcggacaacgagatgcccccggaggccctgagccagggc
tgcaaggacatcgcctaccagctcatgcacaacgtcagggacatcgaggtgatcatgggg
ggcggccggaagtacatgttccccaagaatagaaccgatgtggagtatgagatggacgag
aaggccaggggcacgaggctggacggcctgaacctcatcgacatctggaagagcttcaaa
ccgaaacacaagcactctcactatatctggaaccgcaccgaactcctggccctcgacccc
tacaccgtggactacctcttgggtctctttgagccaggggacatgcagtatgagctcaac
aggaacaacgtgactgacccttcactctccgagatggtggagatggccatcaagatcctg
aacaagaaccccaaaggcttcttcttgctggtggaagggggaaggattgaccacgggcac
cacgagggcaaagccaagcaggcactgcacgaggcggtggagatggaccgggcaatcggg
caggcaggcaccatgacctccgtggaagacacgctgaccgttgtcaccgccgaccactcc
cacgtctttacctttggcggatacaccccccgtggcaactctatttttggtctggccccc
atgctgagtgacacagacaagaagcctttcactgccatcctgtacggcaatgggcctggc
tacaaggtggtgggcggtgagcgagagaatgtctccatggtggactacgctcacgacaac
taccaggcacagtccgccgtgcccctgcgccacgagacccacggcggggaggacgtagcc
gtcttcgccaagggccccatggcacacctgctgcacggcgtccacgagcagaactacatc
ccccacgtgatggcttacgcagcctgcatcggtgccaaccgcgaccactgtgcctccacc
agcttgtcaggcagcccctccccaggccctctgctgttcctgctggccctgctccccctg
ggcatcctgttctga

DBGET integrated database retrieval system