KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007670Help
Entry
103007670         CDS       T03086                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase beta
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00511  Other glycan degradation
bacu00600  Sphingolipid metabolism
bacu01100  Metabolic pathways
bacu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    103007670 (GBA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103007670 (GBA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    103007670 (GBA)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103007670 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 103007670
NCBI-ProteinID: XP_007178499
Position
Un
AA seq 536 aa AA seqDB search
MELSSPSREECPKPRDRVGILAPSLMGLLLLQAVSWASGARPCSPKSFGYSSVVCVCNAT
YCDSLDPLTLPDPGTFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSPPARDLLLKSYFSKEGIEYNIMRVPMASCDFSIRTYTYADTPDD
FQLLNFSLPEEDVKLKIPLIHQALELAQRPVSLFASPWTSPTWLKTNGAVNGKGTLKGHP
GDLYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLFSGYPFQCLGFTPEHQRDFIA
RDLGPTLANSTHRNVRLLMLDDQRLLLPHWAQVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPDTMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVVGWTDW
NLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASEK
NDLDTVALIHPDGSAVVVVLNRSSKDVPLTIKDPAVGFVETISPGYSIHTYLWRRQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagctttcaagtccttccagagaggagtgtcccaagccccgggacagagtaggcatc
ttggctcccagcctcatgggattgcttctacttcaggccgtgtcgtgggcatcaggtgcc
cgcccctgcagccctaaaagctttggctacagctcagtggtctgtgtctgcaatgctaca
tactgtgactctcttgaccccctgaccctgcctgaccctggtaccttcagccgctttgag
agcacacgcagtgggcgccgaatggagctgagtctggggaccatccaggccaaccgcaca
ggcacagggctgctattgaccctgcagccagatcagaagttccagaaagtgaagggtttt
ggaggggccatgacagatgctgctgctctcaacatccttgccctgtcacctcctgcacgg
gatttactactcaaatcgtacttctctaaagaaggaatcgaatacaacatcatgcgggtc
cccatggccagctgtgacttctccatccgcacctacacctatgctgacacccctgatgac
ttccagttgctcaacttcagcctcccagaggaagatgtcaagctcaagatacccctgatc
caccaagccctggagttggcccagcgccctgtctcactctttgccagtccctggacatca
cccacttggctcaagaccaatggggcagtgaatgggaaggggacactcaagggtcatcca
ggggatctctaccaccagacctgggccagatactttgtcaagttcctagatgcctatgct
gagcacaagttacagttctgggcagtgacagctgagaacgagccttctgcagggctattt
agcgggtaccccttccagtgcctgggcttcacccctgaacaccagcgagacttcatcgcc
cgtgacctgggtcccaccctcgccaacagtacacaccgcaatgtccgactgctcatgcta
gatgaccaacgcttgctgctgccccactgggcccaggtggtgctggcagacccagaggca
gctaagtatgttcatggcatcgctgtacattggtacctggactttctggctccagcaaaa
gccaccctgggggagacacatcgcctgttccccgacaccatgctctttgcctcagaggcc
tgtgtgggctccaagttctgggagcagagcgtgcggctgggctcctgggatcgaggggtg
cagtacagccacagcatcatcacgaacctcctctaccatgtggtcggctggactgactgg
aacctcgccctaaaccctgaggggggacccaattgggtgcgcaactttgtcgacagcccc
atcatcgtggacatcgccaaggacacattttacaaacagcccatgttttaccaccttggc
cacttcagcaagttcattcctgagggctcccagagagtggggctggttgccagtgagaag
aatgacttggacacagtggcactgatacatcccgatggctctgcagttgtggtcgtgcta
aaccgctcctctaaggacgtgcctcttaccatcaaggaccctgcggtgggcttcgtggaa
actatctcacctggctactccattcacacctacctgtggcgtcgccagtga

DBGET integrated database retrieval system