KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010534Help
Entry
103010534         CDS       T03086                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103010534
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     103010534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 366 aa AA seqDB search
MKLQTGCDGQTPNELEYLEQRRRGAWRVSPRRLAHPPPRTGYVVEGTAGPGAGAGSLFLA
RGRPLGAGASQQLGHVVLSPVWFLYSLLMKLFQRSTPAITLENPDIKYPLRLIDKEVISH
DTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVIRPYTPISSDDDKGFVDLVIKIYFK
DTHPKFPAGGKMSQYLESMKIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPVITTVKSV
GMIAGGTGITPMLQLIRAIMKDPDDQTVCHLLFANQTEKDILLRPELEELRNEHSARFKL
WYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPQPMIQYACLPNLDSVGHPK
ERCFAF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaactggctgcgatggacagacgccgaatgaactggaatatctggagcag
cggagacgcggggcgtggagggtaagcccccgccgactcgcacacccgccccccaggacc
ggctacgtggttgaagggacagcaggacctggcgcgggcgcagggagccttttcctggcc
cgagggcgccccctgggggccggagcctcccagcagttgggccacgtggtcctctcccca
gtctggtttctgtatagcctgctcatgaagctgttccagcgctccaccccggccatcacc
ctcgagaacccggacatcaagtacccgctgcggctgattgacaaggaggtcatcagccat
gatacccgccggttccgctttgctctgccgtcgccccagcacatcctgggcctccccgtc
ggccagcacatctacctctcggctcgaatcgatgggaacctggtcattcggccctacacg
cccatctccagcgatgacgacaagggcttcgtggacctggtcatcaagatttacttcaaa
gacacccaccccaagtttcctgctggagggaagatgtcccagtacctggaaagcatgaag
attggagacaccattgagttccgaggcccaagtgggctgctggtctaccagggcaaagga
aagtttgccatccgtccagacaagaaatccaaccctgtcatcacaacagtgaagtctgtg
ggcatgattgcaggaggaacgggcatcaccccgatgctgcagttgatccgtgccatcatg
aaggacccggatgatcagaccgtgtgccacctgctctttgccaaccagactgagaaggac
atcctgctgcggcccgagctggaggaactgaggaacgaacattctgcgcgcttcaagctc
tggtacacggtggacagagcccccgaagcctgggactacagccagggctttgtgaacgag
gagatgatccgggaccaccttccgcccccagaggaggagccgctggtgctgatgtgcgga
ccccagcccatgatccagtacgcctgcctgcccaacctggacagcgtgggccaccccaag
gagcgctgcttcgccttctga

DBGET integrated database retrieval system