KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016960Help
Entry
103016960         CDS       T03086                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    103016960 (LYZ)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     103016960 (LYZ)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103016960 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 217 aa AA seqDB search
MVILRTSEYPSSNIRKKTFKVSGPINGSCFPHVSKGGAARPLGEEGSEKMLNTRTSSAWS
AWRSGFSVNMKAVLILGLLLLSVAVQGKIFERCELARTLKRLGLDGFKGISLANWVCLAK
WESSYNTRATNYNPGSRSTDYGIFQINSRYWCNDGKTPRASNGCHIHCSVLLKDDITEAV
RCAKRVVQDPQGIKAWVAWRNRCQNQDLRSYVQGCGV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggtcatccttaggacctcagaatatccctcttcaaacataaggaagaaaacttttaaa
gtcagtggaccaataaacggttcctgttttccacatgtctcaaagggtggagctgccaga
ccactcggagaagaaggaagtgaaaagatgttaaataccaggaccagctcagcctggtca
gcctggaggtctggcttctcagtcaacatgaaggctgtgcttattctggggcttctcctc
ctttctgtcgctgtccaaggcaagatctttgagaggtgtgagcttgccagaactctgaaa
agacttggattggatggctttaagggaatcagcctggcaaactgggtgtgtttggccaaa
tgggaaagcagttataacacacgagctacaaactacaatcctggaagccgaagcactgat
tatgggatatttcaaatcaatagccgctactggtgtaatgatggcaaaaccccaagagca
tctaacggctgtcacatacactgcagcgtgttgctgaaagatgacatcactgaagctgta
cgatgtgcaaagagggttgtccaagatccacaaggcattaaagcatgggtggcatggaga
aatcgttgtcaaaaccaagatctcaggagttatgttcagggttgcggagtgtaa

DBGET integrated database retrieval system