KEGG   Bifidobacterium adolescentis: BAD_0048Help
Entry
BAD_0048          CDS       T00437                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bad  Bifidobacterium adolescentis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAD_0048
Enzymes [BR:bad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BAD_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61460..62524
Genome map
AA seq 354 aa AA seqDB search
MTLRLLDEANYDAEMESKVLPALDACMTEGWMDPATVDWNGDALPKLDEPGRLHYCCYDA
AKFDVLREDGASGVFRGAIVISHGFTEFARKYSEMAWYFLLAGYSVCILEHRGHGHSVHD
VDNPSLVWIDDWRRYVSDFAAFADTVGREYACGEPLNLYCHSMGGGIGAAVMEHYPSLFD
KAVLSAPMIAPVVGMPTWIARIATGALCGLGFGKARVFGHTDFSPELDLDEHKGASEARV
RWFHKQRVDDVACQTNAATFEWAHQAMALSRAVLKPDMCGAIETPTLLFQAGRDVWVLNG
PQDDFVERVREGGGLIEKIRYGKSLHEIFSMPNTVVGPYVNKILDFFSAPADSL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgactcttaggctgctcgacgaggcgaattacgacgccgaaatggaaagcaaggtgctg
cccgcgctggacgcctgcatgacggaaggatggatggatccagccaccgttgactggaac
ggcgacgcgctgcccaaactggacgaacccggccggttgcactattgctgttacgacgcg
gccaaattcgacgtgctgcgtgaggacggcgcttcgggcgtgttccgcggtgcgatcgtc
atttcgcacggattcaccgaattcgcgcgaaaatacagcgagatggcatggtatttcctg
ctggccggctattccgtatgcatcctcgagcatcgcgggcacggtcattccgtgcatgac
gtggacaatcccagcctggtgtggatcgacgattggcgccggtatgtgtccgatttcgca
gccttcgccgacactgtgggccgcgaatacgcgtgcggcgagccactgaacctgtactgc
cattcgatgggcggcggcatcggcgcggccgtgatggaacactatccgagcctgttcgac
aaggccgtgttgtccgcacccatgatcgcccccgtcgtcggtatgccgacatggatcgca
cgcatcgctacaggcgcgttgtgcggcttgggattcggcaaagcgcgcgtattcggtcac
accgatttttcccccgaactcgatctcgacgagcataagggcgcgtccgaggcgcgcgtt
cgctggttccacaagcagcgcgtcgacgacgtggcatgccagaccaacgcggccaccttc
gaatgggcgcatcaggcgatggcattgtctcgagccgtactcaaaccggacatgtgcggt
gcgatcgaaactccgacgctgctgttccaagcgggccgtgacgtctgggtcctgaacggt
ccgcaggacgatttcgtggaacgcgtgcgcgaaggcggcggattaatcgaaaaaatacgg
tacggcaagtcgttgcacgagatcttctccatgccgaacacggtggtcggaccgtatgtg
aacaagattctcgacttcttcagcgcgcccgcggacagtctgtga

DBGET integrated database retrieval system