KEGG   Bifidobacterium adolescentis: BAD_0138Help
Entry
BAD_0138          CDS       T00437                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bad  Bifidobacterium adolescentis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bad03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189152..189754
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFANLPGIGPKGAQRIAFYLLNAPDEESQALIDAITEVKEKVRFCD
ICGNVCETSPCPVCADPRRDHSVICVVEEPKDVMSIERTREYRGMYHVLGGVINPMANVQ
PSDLNIAKLIERLKDSEVKEVILALNPNVEGEATTSFLSQLLSQTDIKVTRLASGLPVGG
DLEYADEITLGRALAGRRAV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttggcctatgacggcgccatccaacgactcatcgacgcgttcgccaacctgccc
ggcatcgggccgaaaggcgcgcaacgcatcgccttctacctgctcaacgcgcccgatgag
gaatcgcaggcactgatcgacgccatcacggaagtcaaggaaaaagtacggttctgcgat
atctgcggcaacgtgtgcgaaaccagcccatgcccggtatgcgccgacccacgccgcgac
cacagcgtgatctgcgtggtcgaagagccgaaggacgtgatgagcatcgaacgcacccgc
gaataccgaggcatgtaccatgtgctgggcggcgtcatcaacccgatggccaacgtgcag
ccaagcgacctcaacatcgccaaactcatcgaacggcttaaggacagcgaagtcaaggag
gtgatcctcgcgctcaacccgaacgtggaaggcgaggccaccaccagcttcctttcgcag
ctgctgagccagaccgacatcaaggtgacgcgccttgccagcggcctgccggtgggcggc
gacctcgaatacgccgacgagatcaccctgggccgtgcgctcgccggccgtcgcgccgtc
tga

DBGET integrated database retrieval system