KEGG   Bifidobacterium adolescentis: BAD_0308Help
Entry
BAD_0308          CDS       T00437                                 

Gene name
malQ1
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bad  Bifidobacterium adolescentis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAD_0308 (malQ1)
Enzymes [BR:bad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BAD_0308 (malQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406327..408498
Genome map
AA seq 723 aa AA seqDB search
MGTMTEQTENATRLARPLIRLAKLVGVATSYVGMSHDYHEIEDDVLVAVLKALGIDASND
EAINQSITSIKSERETRVVAPTVLHIVGKESKVEVHGGMFDVPEASITLENGKQFTGKIS
HEGGEKIAHEIDSSFFFTSYLVLPADLPEGYHTLEVTVGNEAETATVISAPEKIELLDDM
KNGSLWGWMSQLYSIRSKGSWGVGDFEDLKTMLVEAKKKTGSDFMLINPMHAAEPVPPLT
PSPYLPISRRFINFSYIRPESMPEYLTLSHEDRAEVDALHEQVESLNDDARLIDRDAMWR
VKKHALWVIYKAGRTKARQAEFDRYLAECGDEIESYATWCLCYDKWGAPSDDADNWVRKY
NRDSEEVAQLREKFPDTLEFYRWLEWVATDQLHAAQQAARKAGMKIGIVADMAVGVHPAG
SDVWWNPERFAKGATVGAPPDMFNQQGQDWSQPPLNPIALEQTGFKVYRDMVHDMFANAG
AVRIDHILGLFRLWWIPEGKPATDGTYVHYDSDVMLGILALEASRAGGVVVGEDLGVVPA
YVSKSLSEHGILGCAVEWFEQMDGVFRTPKDWRPYALASVNTHDMPPAAGYLEYGHVKLR
EQLGLLSGPVEEFQKSATAEHNAMLNMLVEEGYLDKAALDDEAANENEIVDALYRGLKGS
PCKLMAASIVDAVGEKRTQNQPGTNNEYPNWRIPLADGEGNVVPLEKLFDEPRLQEITAI
MRG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
ctgggaaccatgacagaacagaccgaaaacgcaacgcgtctcgcccgtccgctcattcgt
ctggcaaagctggtgggtgtcgccaccagctacgtcggtatgagccatgattaccacgaa
atcgaagacgatgttctggtggcggtgctcaaggcgcttggtattgacgcttccaacgat
gaggcgatcaaccagtccatcacatccatcaagtccgaacgcgaaacgcgcgtggtggct
cccaccgtgctgcatatcgtgggcaaggaaagcaaggtggaggtgcacggcggcatgttc
gatgtgccggaagcctccatcacgctggaaaacggcaagcaattcacgggcaaaatctcc
catgagggcggtgagaaaatcgcccatgagattgatagcagcttcttcttcacgtcgtat
ctcgtcctgcccgccgatctgcccgaaggctatcacaccctcgaggtcactgtcggcaac
gaggcggagactgcaaccgttatcagcgctcctgagaaaatcgaactgctcgatgatatg
aagaacggctccctgtgggggtggatgagccagctgtactccatccgttccaagggatcc
tggggcgtgggagacttcgaagatctgaagaccatgctggtcgaggccaaaaagaagacc
ggctccgacttcatgcttatcaacccgatgcacgccgcggagccggtgcctccgctgacg
ccatcgccgtatctgccgatttcccgccgtttcatcaatttcagctacatccgtccggag
tccatgccggaatatctcacgctgtcccacgaggacagggctgaagtcgatgcgctgcac
gagcaggtcgaatcgctgaatgacgacgcgcggctgatcgatcgcgacgccatgtggcgc
gtcaagaagcatgcgctgtgggtcatctacaaggccggccgaaccaaggctcgccaggcc
gaattcgaccgttacctcgccgaatgcggagacgagatcgaatcctacgccacctggtgc
ctgtgctacgacaagtggggagctccctccgacgacgccgataattgggtgcgcaaatac
aaccgtgattccgaagaagtcgcgcagttgcgtgagaagttcccggacacccttgagttc
taccgctggcttgagtgggtcgccaccgatcagttgcacgcggcgcagcaggccgcccgc
aaggccggtatgaagatcggcatcgtcgcggatatggccgtcggcgtgcatccggcagga
tccgatgtgtggtggaatccggaacgcttcgccaagggcgccacggtcggtgccccgccg
gacatgttcaaccagcagggccaggattggagccagccgccgcttaacccgatcgccctc
gaacagaccggattcaaggtgtaccgggatatggtgcatgacatgttcgccaatgccggt
gcggtgcgtatcgatcatatccttggtctgttccgcctatggtggattccggaaggcaag
cccgccactgatggcacatatgtgcattacgattccgatgtcatgctcggcattctcgcg
cttgaggcttcccgcgctggtggcgtggttgtcggcgaggatctgggtgtcgtgccggcc
tatgtgtccaagtcgctgtccgaacatggcattctcggttgtgccgtggaatggttcgaa
cagatggacggtgtgttccgcactccgaaggattggcgtccgtacgcactggcgtccgtc
aatacgcatgacatgcctccggcggccggttacctcgaatatggccacgtcaagttgcgt
gagcagctcggcctgctgtccggtccggtggaggaattccagaagtccgcaaccgccgag
cacaatgccatgctgaacatgctggtcgaggagggctatctcgacaaggctgctctggat
gacgaagccgccaacgaaaacgagattgtcgacgcgctgtaccgtggtctgaaaggttcg
ccctgcaagctcatggccgcctccatcgtcgacgcggtcggtgagaagcgcacgcagaac
cagccgggcaccaataacgagtatccgaattggcgtattccgctggccgatggcgaaggc
aacgtggtgccgctcgaaaagctcttcgacgaaccgcgtctgcaagagatcaccgccatc
atgcgtggctga

DBGET integrated database retrieval system