KEGG   Bifidobacterium adolescentis: BAD_0319Help
Entry
BAD_0319          CDS       T00437                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bad  Bifidobacterium adolescentis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAD_0319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAD_0319
   00620 Pyruvate metabolism
    BAD_0319
   00650 Butanoate metabolism
    BAD_0319
  Lipid metabolism
   00071 Fatty acid degradation
    BAD_0319
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAD_0319
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAD_0319
   00626 Naphthalene degradation
    BAD_0319
Enzymes [BR:bad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAD_0319
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BAD_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419606..422338
Genome map
AA seq 910 aa AA seqDB search
MADAKKKEEPTKPTPEEKLAAAEAEVDALVKKGLKALDEFEKLDQKQVDHIVAKASVAAL
NKHLVLAKMAVEETHRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVLGIDEIAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPGAQNCSVAAAKIVRDAAIAAGAP
ENCIQWIEHPSIEATGALMKHDGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDK
NVDVVRAANDLILSKHFDYGMICATEQAIIADKDIYAPLVKELKRRKAYFVNADEKAKLE
QYMFGCTAYSGQTPKLNSVVPGKSPQYIAKAAGFEIPEDATILAAECKEVGENEPLTMEK
LAPVQAVLKSDNKEQAFEMCEAMLKHGAGHTAAIHTNDRDLVREYGQRMHACRIIWNSPS
SLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLINIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVERGAAMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEISFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHAFEAYVSVYANDFTDGMALHAAKLVWDNLAESVNGEPGEEKTRA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHVAHGRTNSILLPYVIRYNGSVPEEP
TSWPKYNKYIAPERYQEIAKNLGVNPGKTPEEGVENLAKAVEDYRDNKLGMNKSFQECGV
DEDYYWSIIDQIGMRAYEDQCAPANPRIPQIEDMKDIAIAAYYGVSQAEGHKLRVQRQGE
AATEEASERA
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacgcaaagaagaaggaagagccgaccaagccgactccggaagagaagctcgcc
gcagccgaggctgaggtcgacgctctggtcaagaagggcctgaaggctcttgatgaattc
gagaagctcgatcagaagcaggttgaccacatcgtggccaaggcttccgtcgcagccctg
aacaagcacttggtgctcgccaagatggccgtcgaggagacccaccgtggtctggtcgaa
gacaaggccaccaagaacatcttcgcctgcgagcatgtcaccaactacctggctggtcag
aagaccgtcggcatcatccgcgaggacgacgtgctgggcatcgacgaaatcgccgagccg
gttggcgtcgtcgctggcgtgaccccggtcaccaacccgacctccaccgccatcttcaag
tcgctgatcgcactgaagacccgctgcccgatcatcttcggcttccacccgggcgcacag
aactgctccgtcgcggccgccaagatcgttcgcgatgccgctatcgcagcaggcgctcct
gagaactgtattcagtggatcgagcatccgtccatcgaggccactggcgccctgatgaag
catgatggtgtcgccaccatcctcgccaccggtggtccgggcatggtcaaggccgcatac
tcctccggcaagccggccctgggcgtcggcgcgggcaatgctccggcatacgttgacaag
aacgtcgacgtcgtgcgtgcagccaacgatctgattctttccaagcacttcgattacggc
atgatctgcgctaccgagcaggccatcatcgccgacaaggacatctacgctccgctcgtt
aaggaactcaagcgtcgcaaggcctatttcgtgaacgctgacgagaaggccaagctcgag
cagtacatgttcggctgcaccgcttactccggacagaccccgaagctcaactccgtggtg
ccgggcaagtccccgcagtacatcgccaaggccgccggcttcgagattccggaagacgcc
accatccttgccgctgagtgcaaggaagtcggcgagaacgagccgctgaccatggagaag
cttgctccggtccaggccgtgctgaagtccgacaacaaggaacaggccttcgagatgtgc
gaagccatgctgaagcatggcgccggccacaccgccgccatccacaccaacgaccgtgac
ctggtccgcgagtacggccagcgcatgcacgcctgccgtatcatctggaactccccgagc
tccctcggcggcgtgggcgacatctacaacgccatcgctccgtccctgaccctgggctgc
ggctcctacggcggcaactccgtgtccggcaacgtccaggcagtcaacctcatcaacatc
aagcgcatcgctcggaggaacaacaacatgcagtggttcaagattccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgaaaaggccgtcatc
gtgtgcgataaggtcatggagcagctcggcatcgttgacaagatcatcgatcagctgcgt
gcacgttccaaccgcgtgaccttccgtatcatcgattatgtcgagccggagccgagcgtg
gagaccgtcgaacgtggcgccgccatgatgcgcgaggagttcgagccggataccatcatc
gccgtcggcggtggttccccgatggatgcgtccaagattatgtggctgctgtacgagcac
ccggaaatctccttctccgatgtgcgtgagaagttcttcgatatccgtaagcgcgcgttc
aagattccgccgctgggcaagaaggccaagctggtctgcattccgacttcttccggcacc
ggttccgaagtcacgccgttcgctgtgattaccgaccacaagaccggctataagtacccg
atcaccgattacgcgctgaccccgtccgtcgctatcgtcgatccggtgctggcacgtact
cagccgcgcaagctggcttccgatgctggtttcgatgctctgacccacgcttttgaggct
tatgtgtccgtgtatgccaacgacttcaccgatggtatggcattgcacgctgccaagctg
gtttgggacaacctcgctgagtccgtcaatggcgagccgggtgaggagaagacccgtgcc
caggagaagatgcataatgccgccaccatggccggcatggctttcggctccgccttcctc
ggcatgtgccacggcatggcccacaccattggtgcactgtgccacgttgcccacggtcgt
accaactccatcctcctgccgtacgtgatccgttacaacggttccgtcccggaggagccg
accagctggccgaagtacaacaagtacatcgctccggaacgctaccaggagatcgccaag
aaccttggcgtgaacccgggcaagactccggaagagggcgtcgagaacctggccaaggct
gttgaggattaccgtgacaacaagctcggtatgaacaagagcttccaggagtgcggtgtg
gatgaggactactattggtccatcatcgaccagatcggcatgcgcgcctacgaagaccag
tgcgcaccggcgaacccgcgtatcccgcagatcgaggatatgaaggatatcgccattgcc
gcctactacggcgtcagccaggcggaaggccacaagctgcgcgtccagcgtcagggcgaa
gccgctacggaggaagcttccgagcgcgcctga

DBGET integrated database retrieval system