KEGG   Bifidobacterium adolescentis: BAD_0378Help
Entry
BAD_0378          CDS       T00437                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bad  Bifidobacterium adolescentis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bad01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bad01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bad00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bad00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bad00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477305..478135
Genome map
AA seq 276 aa AA seqDB search
MQRNENCCKTWGVNRRKRLVLGVPSGRLASMTYKLVLLRHGQSAWNKTNQFTGWVDVPLT
EQGVEEAKNGGRLLKEKNVLPDIVFTSMLRRAINTANVALDEADRLWIPVKRSWRLNERH
YGALQGKNKTEIRQEYGDEKFMLWRRSYATPPPEIDPNDEYAQNNDPRYTGDPVPEAECL
ADVVKRVEPYFKSDIEPELKAGKTVLIAAHGNSLRAIVKMLDNLSEEEIAKVNIPTAMPL
LYELDENFKPIKPRGEYLDPEAAAAGAAAVAAQGQK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgaaatgaaaattgttgcaaaacgtggggcgtcaatcgtcggaaacggcttgtt
ttgggtgtgccaagcggtagacttgcaagcatgacttacaaactagtactgctccgtcac
ggacagagcgcatggaataaaaccaatcagttcaccggctgggtcgacgtcccgctgacc
gagcagggtgtcgaggaagccaagaacggcggccgcctgctcaaggagaagaacgtcctg
cctgacatcgtcttcacctcgatgctgcgtcgcgccatcaacaccgccaacgtcgcgctg
gacgaggccgatcgcctgtggattccggtcaagcgcagctggcgtctgaacgagcgtcac
tacggcgccctgcagggcaagaacaagaccgagatccgtcaggagtacggtgacgagaag
ttcatgctgtggcgtcgttcctacgccacaccgccgccggagatcgatccgaacgacgag
tacgcgcagaacaacgatccgcgctacaccggcgatccggttccggaagccgagtgcctg
gccgacgtggtcaagcgcgttgagccgtacttcaagtccgacatcgagccggagctgaag
gctggcaagaccgttctgatcgccgctcacggcaactccctgcgcgccatcgtgaagatg
ctggacaacctctccgaagaggagatcgccaaggtcaacatcccgaccgcaatgccgctg
ctgtacgagctggacgagaacttcaagccgatcaagccgcgtggcgagtacctggatccg
gaagccgccgctgccggtgctgccgccgtcgccgctcagggccagaagtga

DBGET integrated database retrieval system