KEGG   Bifidobacterium adolescentis: BAD_0640Help
Entry
BAD_0640          CDS       T00437                                 

Definition
B-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bad  Bifidobacterium adolescentis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAD_0640
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BAD_0640
Enzymes [BR:bad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BAD_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(799598..800896)
Genome map
AA seq 432 aa AA seqDB search
MGCSVACSYEGNIWGMPACHNGGMKKAHGFFTRLVAACCVAMLPVTLAACSGDASPSDAA
TAAFSTRRPTVTHDSLDKAQVPSVRDDSPHAKAVRAVESMSVEERVGQLVMAPLFAGSDP
SSLYDLIANRHVGSVLIIGNWTSGIAGVAAATSTLQSYAPGDNQLLMSTDQEGGLVQHLK
GAGFDTMPSATQQGAMDVSQLRQSASAWGTQLKAAGINVDLAPVVGTVTVDRSSNAPIGA
LYRDFGLDPAGNADHAKAFIQGMSDSGVGSAIKHYPGLGSVTGNTDFTANGILDTTTTLD
GPEISAFNGTLEASPSMVMMSLATYQAIDPNNPAVFSSTLVTGYLRGKIGFQGVVTSDSL
SATALSGVQPSDLGVRLVEAGGDLACIGASSYVQPVLDGLNAKAAGDATFARKVQQSAIR
VMTLKYEMGLAR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atcggctgttccgtggcatgttcgtatgaagggaacatatggggaatgccggcatgccat
aatggcggtatgaagaaggctcatgggtttttcacacgattggtggctgcctgctgcgtg
gcgatgctgccggtcacgttggccgcatgttccggcgacgcttccccatcggacgccgcc
accgcagctttttccactcgccggccgacggtcacgcatgattccctcgacaaggcgcaa
gtgccgtccgtccgcgacgattcgccgcatgccaaggcggtgcgggccgtggagtccatg
agtgtcgaggaacgggtcgggcagctggttatggcaccattgttcgctggttccgatccg
tcatcgttgtatgacctcattgcgaacaggcatgttggttcggttttgatcatcggcaac
tggacttcggggatcgccggggtcgcggccgccacatccacgctgcaatcgtatgctccg
ggcgacaaccagctgttgatgtccaccgatcaggagggtggtctggtccagcatctcaag
ggggccgggtttgataccatgccttcggccacccagcagggcgcaatggatgtcagccag
ttgaggcaatcggcatccgcatggggcacgcagctcaaggctgcgggcatcaatgtcgat
ctggcgcccgtcgtcggcacggtgaccgtggaccgttcgtcgaacgccccgattggcgcg
ctgtaccgtgatttcggtcttgatccggccggcaatgcggaccatgcgaaggcgttcata
cagggcatgtccgattcgggggtaggcagcgccatcaaacattatccgggtttgggatcg
gtgaccggcaataccgatttcaccgcgaacggcatcctcgacaccaccaccacgttggat
ggtccggaaatcagcgcgttcaacggcacgttggaggcaagcccttcgatggtgatgatg
tctttggccacatatcaggcgatcgatccgaataatccggccgtgttctcatcaacgctg
gtcaccggctatctgcgcgggaaaatcggcttccaaggcgtcgtcacttccgattccctg
tccgcaacggctttgagtggcgtgcagccgagtgatttgggtgtgcggctggtcgaagcc
ggcggcgatttggcatgtatcggcgcctcttcctacgtgcagccggtgttggacggattg
aacgccaaagcggccggcgatgcgacgttcgcgcggaaggtgcagcaatccgccattcgt
gtgatgacgctcaaatacgagatggggctcgccaggtaa

DBGET integrated database retrieval system