KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0645Help
Entry
BAD_0645          CDS       T00437                                 

Gene name
eno
Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00010  Glycolysis / Gluconeogenesis
bad00680  Methane metabolism
bad01100  Metabolic pathways
bad01110  Biosynthesis of secondary metabolites
bad01120  Microbial metabolism in diverse environments
bad01130  Biosynthesis of antibiotics
bad01200  Carbon metabolism
bad01230  Biosynthesis of amino acids
bad03018  RNA degradation
Module
bad_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAD_0645 (eno)
  Energy metabolism
   00680 Methane metabolism
    BAD_0645 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BAD_0645 (eno)
Enzymes [BR:bad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BAD_0645 (eno)
Messenger RNA biogenesis [BR:bad03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BAD_0645 (eno)
Exosome [BR:bad04147]
 Exosomal proteins
  Proteins found in most exosomes
   BAD_0645 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: BAF39426
UniProt: A1A143
Position
809189..810487
Genome map
AA seq 432 aa AA seqDB search
MAVIESVYARQILDSRGNPTVEVVLDTDDGAQGLGLVPSGASTGEAEAWERRDGDKSVYQ
GKGVLNAVKAVNEEIAPKVIGMDASDQRALDETMIELDGTPNKGRLGANAILGVSLAALY
ASAESADQPLYRYIGGTNGHILPVPNMNIMNGGAHADFATDIQEYMISPYGFNTYSEALQ
AGVEVYHTLKNVLKKQGLNTGLGDEGGFAPKMKSNKDSLNYIMDAISAAGYEPGKQIGIS
LDVASSEFYNKETGKYHFEGDDREAGYMLDFYENLINEYPIVSIEDPFQEEGWDDWAAIT
AKLGDRLQFVGDDLLVTNPARLAKGIKLGAANSLLVKLNQIGTVTETLDAIELATKNGFT
SMVSHRSGETPDTTISDLAVAKNTGQIKTGAPARGERIAKYNRLLEIEEELGSTAQYAGY
SAFKACKKYIAE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtaattgaaagcgtttacgcgcgtcagattctcgattcccgcggcaacccgacc
gtcgaggtcgttcttgacaccgatgacggtgctcagggcctgggcctcgttccgtccggt
gcttccaccggcgaagccgaggcttgggagcgtcgcgatggcgacaagtctgtttaccag
ggcaagggtgtgctcaacgccgtcaaggccgtgaacgaggagatcgctccgaaggtcatc
ggcatggacgcttccgatcagcgcgctctcgatgagaccatgatcgagctcgacggcacc
ccgaacaagggccgtctgggcgccaacgccatcctcggcgtgtccctggccgctctgtac
gcttccgccgagtccgcggatcagccgctgtaccgctacatcggcggcaccaacggccac
atcctgccggtcccgaacatgaacatcatgaacggtggcgcccacgctgacttcgccacc
gacatccaggagtacatgatctccccgtacggcttcaacacctacagcgaggctctgcag
gctggcgtcgaggtctaccacaccctgaagaacgtcctgaagaagcagggcctgaacacc
ggcctcggcgacgagggcggcttcgctccgaagatgaagtccaacaaggactccctgaac
tacatcatggacgccatctccgccgccggctacgagccgggcaagcagatcggcatctcc
ctcgatgtggcttcctccgagttctacaacaaggagaccggcaagtaccacttcgaaggc
gacgaccgtgaggccggctacatgctcgacttctacgagaacctcatcaacgagtacccg
atcgtctccatcgaggatccgttccaggaagaaggctgggacgactgggcggccatcacc
gccaagctcggcgatcgcctgcagttcgtcggcgacgacctgctggtcaccaacccggca
cgtctggccaagggcatcaagctcggcgccgccaactccctgctggtcaagctcaaccag
atcggcaccgtcaccgagaccctcgacgccatcgagctggccaccaagaacggcttcacc
tccatggtttcccaccgttccggcgagaccccggacaccaccatctccgacctggctgtg
gcaaagaacaccggccagatcaagaccggtgccccggctcgtggcgagcgtatcgccaag
tacaaccgcctgctcgagattgaggaggagctcggctccaccgctcagtacgccggctac
agcgctttcaaggcctgcaagaagtacatcgccgagtga

DBGET integrated database retrieval system