KEGG   Bifidobacterium adolescentis: BAD_0645Help
Entry
BAD_0645          CDS       T00437                                 

Gene name
eno
Definition
phosphopyruvate hydratase
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
bad  Bifidobacterium adolescentis
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bad01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bad01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bad00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bad00680]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:bad03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
809189..810487
Genome map
AA seq 432 aa AA seqDB search
MAVIESVYARQILDSRGNPTVEVVLDTDDGAQGLGLVPSGASTGEAEAWERRDGDKSVYQ
GKGVLNAVKAVNEEIAPKVIGMDASDQRALDETMIELDGTPNKGRLGANAILGVSLAALY
ASAESADQPLYRYIGGTNGHILPVPNMNIMNGGAHADFATDIQEYMISPYGFNTYSEALQ
AGVEVYHTLKNVLKKQGLNTGLGDEGGFAPKMKSNKDSLNYIMDAISAAGYEPGKQIGIS
LDVASSEFYNKETGKYHFEGDDREAGYMLDFYENLINEYPIVSIEDPFQEEGWDDWAAIT
AKLGDRLQFVGDDLLVTNPARLAKGIKLGAANSLLVKLNQIGTVTETLDAIELATKNGFT
SMVSHRSGETPDTTISDLAVAKNTGQIKTGAPARGERIAKYNRLLEIEEELGSTAQYAGY
SAFKACKKYIAE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtaattgaaagcgtttacgcgcgtcagattctcgattcccgcggcaacccgacc
gtcgaggtcgttcttgacaccgatgacggtgctcagggcctgggcctcgttccgtccggt
gcttccaccggcgaagccgaggcttgggagcgtcgcgatggcgacaagtctgtttaccag
ggcaagggtgtgctcaacgccgtcaaggccgtgaacgaggagatcgctccgaaggtcatc
ggcatggacgcttccgatcagcgcgctctcgatgagaccatgatcgagctcgacggcacc
ccgaacaagggccgtctgggcgccaacgccatcctcggcgtgtccctggccgctctgtac
gcttccgccgagtccgcggatcagccgctgtaccgctacatcggcggcaccaacggccac
atcctgccggtcccgaacatgaacatcatgaacggtggcgcccacgctgacttcgccacc
gacatccaggagtacatgatctccccgtacggcttcaacacctacagcgaggctctgcag
gctggcgtcgaggtctaccacaccctgaagaacgtcctgaagaagcagggcctgaacacc
ggcctcggcgacgagggcggcttcgctccgaagatgaagtccaacaaggactccctgaac
tacatcatggacgccatctccgccgccggctacgagccgggcaagcagatcggcatctcc
ctcgatgtggcttcctccgagttctacaacaaggagaccggcaagtaccacttcgaaggc
gacgaccgtgaggccggctacatgctcgacttctacgagaacctcatcaacgagtacccg
atcgtctccatcgaggatccgttccaggaagaaggctgggacgactgggcggccatcacc
gccaagctcggcgatcgcctgcagttcgtcggcgacgacctgctggtcaccaacccggca
cgtctggccaagggcatcaagctcggcgccgccaactccctgctggtcaagctcaaccag
atcggcaccgtcaccgagaccctcgacgccatcgagctggccaccaagaacggcttcacc
tccatggtttcccaccgttccggcgagaccccggacaccaccatctccgacctggctgtg
gcaaagaacaccggccagatcaagaccggtgccccggctcgtggcgagcgtatcgccaag
tacaaccgcctgctcgagattgaggaggagctcggctccaccgctcagtacgccggctac
agcgctttcaaggcctgcaagaagtacatcgccgagtga

DBGET integrated database retrieval system