KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0645Help
Entry
BAD_0645          CDS       T00437                                 

Gene name
eno
Definition
phosphopyruvate hydratase
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAD_0645 (eno)
   01230 Biosynthesis of amino acids
    BAD_0645 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAD_0645 (eno)
  Energy metabolism
   00680 Methane metabolism
    BAD_0645 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BAD_0645 (eno)
Enzymes [BR:bad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BAD_0645 (eno)
Messenger RNA biogenesis [BR:bad03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BAD_0645 (eno)
Exosome [BR:bad04147]
 Exosomal proteins
  Proteins found in most exosomes
   BAD_0645 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
809189..810487
Genome map
AA seq 432 aa AA seqDB search
MAVIESVYARQILDSRGNPTVEVVLDTDDGAQGLGLVPSGASTGEAEAWERRDGDKSVYQ
GKGVLNAVKAVNEEIAPKVIGMDASDQRALDETMIELDGTPNKGRLGANAILGVSLAALY
ASAESADQPLYRYIGGTNGHILPVPNMNIMNGGAHADFATDIQEYMISPYGFNTYSEALQ
AGVEVYHTLKNVLKKQGLNTGLGDEGGFAPKMKSNKDSLNYIMDAISAAGYEPGKQIGIS
LDVASSEFYNKETGKYHFEGDDREAGYMLDFYENLINEYPIVSIEDPFQEEGWDDWAAIT
AKLGDRLQFVGDDLLVTNPARLAKGIKLGAANSLLVKLNQIGTVTETLDAIELATKNGFT
SMVSHRSGETPDTTISDLAVAKNTGQIKTGAPARGERIAKYNRLLEIEEELGSTAQYAGY
SAFKACKKYIAE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtaattgaaagcgtttacgcgcgtcagattctcgattcccgcggcaacccgacc
gtcgaggtcgttcttgacaccgatgacggtgctcagggcctgggcctcgttccgtccggt
gcttccaccggcgaagccgaggcttgggagcgtcgcgatggcgacaagtctgtttaccag
ggcaagggtgtgctcaacgccgtcaaggccgtgaacgaggagatcgctccgaaggtcatc
ggcatggacgcttccgatcagcgcgctctcgatgagaccatgatcgagctcgacggcacc
ccgaacaagggccgtctgggcgccaacgccatcctcggcgtgtccctggccgctctgtac
gcttccgccgagtccgcggatcagccgctgtaccgctacatcggcggcaccaacggccac
atcctgccggtcccgaacatgaacatcatgaacggtggcgcccacgctgacttcgccacc
gacatccaggagtacatgatctccccgtacggcttcaacacctacagcgaggctctgcag
gctggcgtcgaggtctaccacaccctgaagaacgtcctgaagaagcagggcctgaacacc
ggcctcggcgacgagggcggcttcgctccgaagatgaagtccaacaaggactccctgaac
tacatcatggacgccatctccgccgccggctacgagccgggcaagcagatcggcatctcc
ctcgatgtggcttcctccgagttctacaacaaggagaccggcaagtaccacttcgaaggc
gacgaccgtgaggccggctacatgctcgacttctacgagaacctcatcaacgagtacccg
atcgtctccatcgaggatccgttccaggaagaaggctgggacgactgggcggccatcacc
gccaagctcggcgatcgcctgcagttcgtcggcgacgacctgctggtcaccaacccggca
cgtctggccaagggcatcaagctcggcgccgccaactccctgctggtcaagctcaaccag
atcggcaccgtcaccgagaccctcgacgccatcgagctggccaccaagaacggcttcacc
tccatggtttcccaccgttccggcgagaccccggacaccaccatctccgacctggctgtg
gcaaagaacaccggccagatcaagaccggtgccccggctcgtggcgagcgtatcgccaag
tacaaccgcctgctcgagattgaggaggagctcggctccaccgctcagtacgccggctac
agcgctttcaaggcctgcaagaagtacatcgccgagtga

DBGET integrated database retrieval system