KEGG   Bifidobacterium adolescentis: BAD_0759Help
Entry
BAD_0759          CDS       T00437                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bad  Bifidobacterium adolescentis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bad00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bad00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956987..958000
Genome map
AA seq 337 aa AA seqDB search
MKGEPLSSVLEPAVETPMVGKSVITLDDLSIRQIQEMLHKAQYIDSHRKEVAHTCEGRVL
ATLFYEPSTRTRLSFETAMLRLGGKVIGFAGAQLASVTKGETIADTLKTVSNYVDVVAIR
HPKEGAALVASRAASVPVINAGDGGHMHPTQTLADLATLQSRFGRVTNLTVGLCGDLTFG
RTVHSLIETLCRFGNVNFVLISPDELKTPQYVLDRINATESCSYTEVKDLVSVIGDLDVL
YMTRVQKERFFNEDDYLRLRDTYILDEAKMAYAKKDMAVLHPLPRVNEIAVEVDDDPRAA
YFEQVKNGMLMRMALESSVVGDELPGYEPLAAKEVEA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgagccgttgtcctcagtactcgaaccggcggtcgaaacgccgatggtcgga
aaaagcgtcatcactctcgatgatctttccattcgtcagattcaggaaatgctgcacaaa
gcgcagtacatcgattcccatcgtaaagaagtggcacacacctgcgaaggcagggtgctt
gccactttgttttatgagccgagcacgcgcacgcgtctgagtttcgaaaccgccatgctg
cgcctcggcggcaaggtgatcggtttcgccggcgcccagctcgcctccgtcaccaagggc
gagacgatcgccgacacgttgaagacggtgtccaactacgtcgacgtggtggccatccgc
catccgaaggaaggcgccgcgctggtcgcatcccgcgccgcctccgtgccggtcatcaac
gcgggcgacggcggacacatgcatccgacgcagacgctcgccgacctggccacgcttcaa
tcgcgcttcggccgtgtcaccaacctgaccgtcggcctgtgcggcgatctgaccttcggc
cgcaccgtgcactccctgatcgaaacactgtgccgcttcggcaacgtcaacttcgtgctc
atcagccccgacgagctcaagaccccgcagtacgtgcttgaccgcatcaacgccaccgaa
tcctgctcctacaccgaagtcaaggatctggtctccgtcatcggcgatcttgacgtgctg
tacatgacccgcgtgcagaaagaacgtttcttcaacgaggacgattatctgcgtctgcgc
gacacctacatcctcgacgaagccaagatggcgtacgccaagaaggacatggccgtgctg
cacccgctgccgcgcgtcaacgaaatcgccgtggaagttgacgacgatccgcgtgcagcc
tacttcgaacaggtcaagaacggtatgctcatgcgcatggcattggaaagctcggtggtc
ggtgacgaactgccgggatacgaaccgctcgcagccaaggaggttgaagcctga

DBGET integrated database retrieval system