KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0790Help
Entry
BAD_0790          CDS       T00437                                 

Gene name
trpBC
Definition
bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAD_0790 (trpBC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAD_0790 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAD_0790 (trpBC)
Enzymes [BR:bad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAD_0790 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991880..993973
Genome map
AA seq 697 aa AA seqDB search
MSVLDELVAGAVEDQRSRENNVPLAEVKRMAFEASAPIDARQWLKKADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEQGGASAISVLTEGRRFLGSLEDFDKVRAAVRIPVLRKDFI
VTEYQIWEARAHGADLVLLIVAALDDVKLKSLLDLAHSLNMTVLVETHTREEIQRAINAG
AKVIGINARNLKDLKVDVNKYNELAADLPDDVIRVAESGVFGSVELEDYARAGADAVLVG
EGVATAANHEQAVERLVKAGARVKASEQTPLASHEGPYFGQFGGRYVPEALITALDELER
VYTEAKADPEFHKELARLNQQYVGRPSPLTEAPRFAQRLKEKTGLDARVFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPSMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGIMNAFLDDERVNLYGYEAGGNGPE
SGRHAIRFAPGTGELGMFQGAKSYLLENPEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDQEAMSAFKDLCETEGIIPAIESSHAVAGAYKAAADLKAKGYEHPVMIINISG
RGDKDMNTAGKWFGYLTDEQAKALESNGAQGNNADGE
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgctcgatgaattggtggcgggagccgtcgaggatcagcgatcaagagaaaac
aacgtgccgctcgctgaggtcaagcggatggcgttcgaggcttcagcgccaatcgatgcg
cgccagtggctgaaaaaggcggatggcattccggtcatcgccgagatcaagcgtgcctcc
ccatccaaaggccatttgagcgatattccggatccggccgctttggcccgcgaatacgag
cagggaggtgcaagcgcgatttccgtgctgactgaaggccgtcggttccttggctctctt
gaagatttcgacaaggtgcgcgccgcagtgaggattcccgtgctgcgcaaggatttcatc
gttaccgaatatcagatttgggaagcacgtgcgcatggtgccgatctggtgctgctcatc
gtcgccgcattggacgacgtcaagctcaagtcgctgctcgatctcgcgcatagcctcaat
atgacggtgctggtggaaacacacacccgtgaggagattcaacgggccatcaatgccggg
gccaaggtcattggcatcaacgcccgcaatcttaaagacctcaaggtggatgtgaacaag
tacaacgaactggccgcggatttgccggacgatgtgattcgcgtggcggaatccggtgtg
ttcggttcggttgagcttgaggattacgcccgtgccggcgcggatgcggtgctggtggga
gaaggcgtggccaccgcggccaaccatgagcaggcagtggaacgattagtaaaggcagga
gcaagagtgaaggcatccgaacagaccccgttggcaagccatgaaggaccatatttcgga
cagtttggcggacgctatgttccggaagcgctgatcacggcgctcgacgagcttgaacgc
gtgtatacggaagccaaggccgatccggaattccataaggaattggcgcggttgaaccag
cagtatgttggacgtccgtccccattgactgaagcgcctcgtttcgcgcagaggctcaag
gagaaaaccggtcttgatgcccgtgtgttcctcaagcgtgaagacctgaaccacaccggc
gcccacaagatcaacaacgcgcttggacaggccctactggtcaagcgcatgggcaaaacc
cgtgtgatcgccgaaaccggtgcaggccagcatggtgtggccactgccacggtctgtgcc
atgctgggactcaagtgccgcatctacatgggacagatcgatgcccgccgtcaggcgctg
aacgttgcccgcatgcgcatgcttggcgcggaggtcgtcgaagtcaccttgggtgatcgc
atcctcaaggacgccatcaacgaggcgctgcgcgactgggtcaccaacgtcaaagacacc
cattatctgctcggcacggtcgcaggacctcatccgttcccatccatggtgcgcgacttc
caaaagatcatcggagaggaagcgaaacagcagctgcaggattggtatggcatcgaccat
cccgatgctatctgcgcatgcgtcggcggcggctccaatgccatcggcatcatgaacgcc
ttcctcgatgacgaacgagtgaacctgtacggttacgaggccggcggtaacgggcccgaa
tccggtcgccatgccattcgattcgcgccaggtaccggtgaactgggcatgttccaagga
gccaagagctatctgttggaaaaccccgaaggccagacccttgacacgtactccatctcc
gcaggcttggattacgcctccgtcggccccgaacatgcatggctcaaggatatcggccgc
gtcaactattcctgggccactgatcaggaagccatgagcgcgttcaaggatctgtgcgaa
accgaaggcatcatccctgccatcgaaagctcccacgcagtggccggcgcgtacaaggca
gctgcagacctcaaggccaaagggtatgagcatccggtcatgatcatcaacatctctggc
cgtggagacaaggacatgaacaccgccggcaaatggttcggatacctgaccgacgagcag
gccaaagccttggaatccaacggcgcgcaaggcaacaacgcggacggcgagtga

DBGET integrated database retrieval system