KEGG   Bifidobacterium adolescentis: BAD_0790Help
Entry
BAD_0790          CDS       T00437                                 

Gene name
trpBC
Definition
bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bad  Bifidobacterium adolescentis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAD_0790 (trpBC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAD_0790 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAD_0790 (trpBC)
Enzymes [BR:bad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAD_0790 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991880..993973
Genome map
AA seq 697 aa AA seqDB search
MSVLDELVAGAVEDQRSRENNVPLAEVKRMAFEASAPIDARQWLKKADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEQGGASAISVLTEGRRFLGSLEDFDKVRAAVRIPVLRKDFI
VTEYQIWEARAHGADLVLLIVAALDDVKLKSLLDLAHSLNMTVLVETHTREEIQRAINAG
AKVIGINARNLKDLKVDVNKYNELAADLPDDVIRVAESGVFGSVELEDYARAGADAVLVG
EGVATAANHEQAVERLVKAGARVKASEQTPLASHEGPYFGQFGGRYVPEALITALDELER
VYTEAKADPEFHKELARLNQQYVGRPSPLTEAPRFAQRLKEKTGLDARVFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPSMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGIMNAFLDDERVNLYGYEAGGNGPE
SGRHAIRFAPGTGELGMFQGAKSYLLENPEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDQEAMSAFKDLCETEGIIPAIESSHAVAGAYKAAADLKAKGYEHPVMIINISG
RGDKDMNTAGKWFGYLTDEQAKALESNGAQGNNADGE
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgctcgatgaattggtggcgggagccgtcgaggatcagcgatcaagagaaaac
aacgtgccgctcgctgaggtcaagcggatggcgttcgaggcttcagcgccaatcgatgcg
cgccagtggctgaaaaaggcggatggcattccggtcatcgccgagatcaagcgtgcctcc
ccatccaaaggccatttgagcgatattccggatccggccgctttggcccgcgaatacgag
cagggaggtgcaagcgcgatttccgtgctgactgaaggccgtcggttccttggctctctt
gaagatttcgacaaggtgcgcgccgcagtgaggattcccgtgctgcgcaaggatttcatc
gttaccgaatatcagatttgggaagcacgtgcgcatggtgccgatctggtgctgctcatc
gtcgccgcattggacgacgtcaagctcaagtcgctgctcgatctcgcgcatagcctcaat
atgacggtgctggtggaaacacacacccgtgaggagattcaacgggccatcaatgccggg
gccaaggtcattggcatcaacgcccgcaatcttaaagacctcaaggtggatgtgaacaag
tacaacgaactggccgcggatttgccggacgatgtgattcgcgtggcggaatccggtgtg
ttcggttcggttgagcttgaggattacgcccgtgccggcgcggatgcggtgctggtggga
gaaggcgtggccaccgcggccaaccatgagcaggcagtggaacgattagtaaaggcagga
gcaagagtgaaggcatccgaacagaccccgttggcaagccatgaaggaccatatttcgga
cagtttggcggacgctatgttccggaagcgctgatcacggcgctcgacgagcttgaacgc
gtgtatacggaagccaaggccgatccggaattccataaggaattggcgcggttgaaccag
cagtatgttggacgtccgtccccattgactgaagcgcctcgtttcgcgcagaggctcaag
gagaaaaccggtcttgatgcccgtgtgttcctcaagcgtgaagacctgaaccacaccggc
gcccacaagatcaacaacgcgcttggacaggccctactggtcaagcgcatgggcaaaacc
cgtgtgatcgccgaaaccggtgcaggccagcatggtgtggccactgccacggtctgtgcc
atgctgggactcaagtgccgcatctacatgggacagatcgatgcccgccgtcaggcgctg
aacgttgcccgcatgcgcatgcttggcgcggaggtcgtcgaagtcaccttgggtgatcgc
atcctcaaggacgccatcaacgaggcgctgcgcgactgggtcaccaacgtcaaagacacc
cattatctgctcggcacggtcgcaggacctcatccgttcccatccatggtgcgcgacttc
caaaagatcatcggagaggaagcgaaacagcagctgcaggattggtatggcatcgaccat
cccgatgctatctgcgcatgcgtcggcggcggctccaatgccatcggcatcatgaacgcc
ttcctcgatgacgaacgagtgaacctgtacggttacgaggccggcggtaacgggcccgaa
tccggtcgccatgccattcgattcgcgccaggtaccggtgaactgggcatgttccaagga
gccaagagctatctgttggaaaaccccgaaggccagacccttgacacgtactccatctcc
gcaggcttggattacgcctccgtcggccccgaacatgcatggctcaaggatatcggccgc
gtcaactattcctgggccactgatcaggaagccatgagcgcgttcaaggatctgtgcgaa
accgaaggcatcatccctgccatcgaaagctcccacgcagtggccggcgcgtacaaggca
gctgcagacctcaaggccaaagggtatgagcatccggtcatgatcatcaacatctctggc
cgtggagacaaggacatgaacaccgccggcaaatggttcggatacctgaccgacgagcag
gccaaagccttggaatccaacggcgcgcaaggcaacaacgcggacggcgagtga

DBGET integrated database retrieval system