KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0791Help
Entry
BAD_0791          CDS       T00437                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAD_0791 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAD_0791 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAD_0791 (trpA)
Enzymes [BR:bad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAD_0791 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
993991..994866
Genome map
AA seq 291 aa AA seqDB search
MTNATSSTPSGQPLGISHKPSPTETMFDEFKAADKPAFIGYLPYGFPDPDYSLKAFRTMV
EHGVNAVEIGLPYSDPVMDGPVIQAASQIAIDNGEKIANVFKAVETVANAGGVPLVMSYW
NLIFHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSTEDRL
KVVADNARGFVYAAARMGVTGERSTIDASPKELVARTRKAGAKNVCVGIGVSTAEQGARV
GSYADGVIVGSALVHTMIDESGKHAVDEATGLKALAAKTEELAEGIHNARN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgcaacatcatccacgccgtccggccagccactcggcatcagccacaagcca
agcccgacggaaaccatgttcgatgaattcaaagccgccgacaagccggcattcatcgga
tatctgccatacggattccctgatccggattattcgctcaaagctttccgcaccatggtc
gaacacggcgtgaacgcggtcgaaatcgggctgccgtattccgaccccgtcatggacggt
cccgtcatccaggcggcatcgcaaatcgccatcgacaatggtgaaaaaatcgccaacgta
ttcaaagcggtggaaacagtggcgaacgccgggggagtgccattggtcatgagctattgg
aacctcatcttccattacggcgtcgaacgattcgcacgtgatttcgaaaacgccggtgga
gccggtctcatcaccccggatctcattccggacgaggccggcgagtggatcgaagcctcc
gaccgtcacggactcgaccgcatcttcctggtatctccggattccaccgaagaccgtctg
aaagtcgttgcggacaatgcgcggggtttcgtctatgctgccgcccgcatgggcgtcacc
ggagaacgctccaccatcgatgcatccccgaaggaactggtcgcccgtacccgcaaggcc
ggtgcgaaaaacgtgtgcgtaggcatcggcgtgtccaccgcggaacagggggctcgtgtc
ggatcgtatgcggacggtgtcatcgtaggctcggctctggtgcataccatgattgacgaa
tccggcaagcatgcagtcgacgaagccaccggtctcaaggccttggcggcgaagactgag
gagcttgccgaaggcatccacaacgcccgcaactga

DBGET integrated database retrieval system