KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0816Help
Entry
BAD_0816          CDS       T00437                                 

Gene name
ugpA
Definition
(GenBank) probable UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00040  Pentose and glucuronate interconversions
bad00052  Galactose metabolism
bad00500  Starch and sucrose metabolism
bad00520  Amino sugar and nucleotide sugar metabolism
bad01100  Metabolic pathways
bad01130  Biosynthesis of antibiotics
Module
bad_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAD_0816 (ugpA)
   00052 Galactose metabolism
    BAD_0816 (ugpA)
   00500 Starch and sucrose metabolism
    BAD_0816 (ugpA)
   00520 Amino sugar and nucleotide sugar metabolism
    BAD_0816 (ugpA)
Enzymes [BR:bad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAD_0816 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-ProteinID: BAF39597
UniProt: A1A1L4
Position
1018486..1019916
Genome map
AA seq 476 aa AA seqDB search
MTEDVFEYSAAKMRKHGMTDMAIAQFRRLYEVWRNEEASSWIREDEVEPLVSVPSFHDVY
ETINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKARQMRFIDIIIGQVLTA
RTRLGVDLPLTLMNSFRTSKDTMKVLQTNKKFHQEDIPMEIIQHQEPKISAETGMPVSFP
ANPELEWCPPGHGDLFSTIWESGLLDALEAQGFKYLFISNSDNLGARPSRTLAQHFENTG
APFMIEVAKRTPADRKGGHIVRDKATGRLMLREMSQVHPDDKDDAQNIDKHPYFNTNSIW
VRIDALKAKLASYDGVLPLPVIRNKKTVDPTDPTSEPVIQLETAMGAAVSLFDGATCVCV
DRMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPDVHLDARYYKNIHDFDARFPYG
VPSLAAAKSVDIDGDWTFGRDVMLFSDARLEDQGEPSYVPNGEYVGPQGVEPDDWV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaggacgtattcgaatactctgccgcgaagatgcggaagcacggaatgaccgac
atggccatcgcccagttccgtcgtctgtacgaggtctggcgcaatgaggaggccagcagt
tggattcgtgaggacgaggtcgaaccgctcgtcagcgttcccagcttccatgacgtgtat
gagaccatcaatcacgacaaggccgttgacgcgttcgccaaaacggcgttcctgaagctt
aacggcggtcttggcacttcgatgggactcgattgcgccaagtcgctgctgccggtacgt
cgccacaaggcacggcagatgcgtttcatcgacatcatcatcggacaggtgttgaccgcg
cggaccagacttggcgtcgatctgccattgactctgatgaactccttccgtacctccaaa
gacaccatgaaggtgctgcagaccaataagaaattccatcaggaagacatcccgatggaa
atcatccagcatcaggagccgaagatcagcgcggaaacgggaatgcccgtcagcttcccg
gccaatccggaactcgaatggtgcccgccgggccacggcgacctgttctccaccatttgg
gaatccggtctgcttgacgcgcttgaggcgcaggggttcaaataccttttcatctccaat
tccgacaacctgggcgcgcgtccctcccgtacgcttgcgcagcatttcgagaatacgggc
gcaccgttcatgatcgaggtcgccaaacgcaccccagccgatcgtaagggcggccacatc
gtgcgagacaaggccacgggccgtctgatgctgcgtgagatgagccaggtccatccagac
gacaaggacgacgcgcagaacatcgacaagcatccgtacttcaacacgaacagcatttgg
gtgcgtatcgatgcgctgaaagcgaaactcgcatcctatgacggcgtgcttccccttccg
gtaatccgcaataagaagacggtcgacccgaccgatccgaccagcgagccggtcattcag
ctggagaccgccatgggagccgcggtgtcgcttttcgatggcgcgacctgcgtatgcgtc
gaccgtatgcgtttcctgccggtgaagaccactgacgatttgttcatcatgcggtccgac
cgattccatctgacggaccagtacgagatggaagacggcaactacatcttccccgacgtc
catttggacgcgcgctattacaagaacatccacgatttcgatgcccgtttcccatacggt
gtgccttcgctcgccgcggcgaaatccgttgatatcgatggcgattggaccttcggcagg
gatgtgatgctgtttagcgacgcgcgactggaggatcaaggcgaaccaagctatgtgccg
aatggcgaatatgtcggcccgcagggcgtggaaccggacgattgggtctga

DBGET integrated database retrieval system