KEGG   Bifidobacterium adolescentis: BAD_0816Help
Entry
BAD_0816          CDS       T00437                                 

Gene name
ugpA
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bad  Bifidobacterium adolescentis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAD_0816 (ugpA)
   00052 Galactose metabolism
    BAD_0816 (ugpA)
   00500 Starch and sucrose metabolism
    BAD_0816 (ugpA)
   00520 Amino sugar and nucleotide sugar metabolism
    BAD_0816 (ugpA)
Enzymes [BR:bad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAD_0816 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1018486..1019916
Genome map
AA seq 476 aa AA seqDB search
MTEDVFEYSAAKMRKHGMTDMAIAQFRRLYEVWRNEEASSWIREDEVEPLVSVPSFHDVY
ETINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKARQMRFIDIIIGQVLTA
RTRLGVDLPLTLMNSFRTSKDTMKVLQTNKKFHQEDIPMEIIQHQEPKISAETGMPVSFP
ANPELEWCPPGHGDLFSTIWESGLLDALEAQGFKYLFISNSDNLGARPSRTLAQHFENTG
APFMIEVAKRTPADRKGGHIVRDKATGRLMLREMSQVHPDDKDDAQNIDKHPYFNTNSIW
VRIDALKAKLASYDGVLPLPVIRNKKTVDPTDPTSEPVIQLETAMGAAVSLFDGATCVCV
DRMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPDVHLDARYYKNIHDFDARFPYG
VPSLAAAKSVDIDGDWTFGRDVMLFSDARLEDQGEPSYVPNGEYVGPQGVEPDDWV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaggacgtattcgaatactctgccgcgaagatgcggaagcacggaatgaccgac
atggccatcgcccagttccgtcgtctgtacgaggtctggcgcaatgaggaggccagcagt
tggattcgtgaggacgaggtcgaaccgctcgtcagcgttcccagcttccatgacgtgtat
gagaccatcaatcacgacaaggccgttgacgcgttcgccaaaacggcgttcctgaagctt
aacggcggtcttggcacttcgatgggactcgattgcgccaagtcgctgctgccggtacgt
cgccacaaggcacggcagatgcgtttcatcgacatcatcatcggacaggtgttgaccgcg
cggaccagacttggcgtcgatctgccattgactctgatgaactccttccgtacctccaaa
gacaccatgaaggtgctgcagaccaataagaaattccatcaggaagacatcccgatggaa
atcatccagcatcaggagccgaagatcagcgcggaaacgggaatgcccgtcagcttcccg
gccaatccggaactcgaatggtgcccgccgggccacggcgacctgttctccaccatttgg
gaatccggtctgcttgacgcgcttgaggcgcaggggttcaaataccttttcatctccaat
tccgacaacctgggcgcgcgtccctcccgtacgcttgcgcagcatttcgagaatacgggc
gcaccgttcatgatcgaggtcgccaaacgcaccccagccgatcgtaagggcggccacatc
gtgcgagacaaggccacgggccgtctgatgctgcgtgagatgagccaggtccatccagac
gacaaggacgacgcgcagaacatcgacaagcatccgtacttcaacacgaacagcatttgg
gtgcgtatcgatgcgctgaaagcgaaactcgcatcctatgacggcgtgcttccccttccg
gtaatccgcaataagaagacggtcgacccgaccgatccgaccagcgagccggtcattcag
ctggagaccgccatgggagccgcggtgtcgcttttcgatggcgcgacctgcgtatgcgtc
gaccgtatgcgtttcctgccggtgaagaccactgacgatttgttcatcatgcggtccgac
cgattccatctgacggaccagtacgagatggaagacggcaactacatcttccccgacgtc
catttggacgcgcgctattacaagaacatccacgatttcgatgcccgtttcccatacggt
gtgccttcgctcgccgcggcgaaatccgttgatatcgatggcgattggaccttcggcagg
gatgtgatgctgtttagcgacgcgcgactggaggatcaaggcgaaccaagctatgtgccg
aatggcgaatatgtcggcccgcagggcgtggaaccggacgattgggtctga

DBGET integrated database retrieval system