KEGG   Bifidobacterium adolescentis: BAD_0831Help
Entry
BAD_0831          CDS       T00437                                 

Definition
bifunctional HTH-domain containing protein/aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bad  Bifidobacterium adolescentis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bad01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bad01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bad00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:bad00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1038351..1039883)
Genome map
AA seq 510 aa AA seqDB search
MTESFSTRLNDAMALRELKQIDFVHAAEKFNIKLGKSHMSQYVSGKTVPRADIAHFLAAY
LRVNEDWLMGKDVPMEEHAAILPDFAGEQPDHVDDASEQPTEGRTMRTFTKSHKLDNVLY
DVRGPVADEAARMEAAGTHILKLNIGNPAPFGFRTPDEVVYDMSQQLPDTEGYSPSKGLF
SARKAIMQYAQLKNIPNVSIDDIYTGNGVSELINLSLSALLDNGDEVLVPSPDYPLWTAC
VNLAGGTAVHYVCDEDSEWYPDIDDMRSKITDKTKAIVIINPNNPTGALYPKEVLQQIVD
LAREHQLMIFSDEIYDRLVMDGLEHISIASLAPDLFCVTFSGLSKSHMIAGWRVGWMVLS
GNKRLAKDYIEGLNMLANMRMCSNVPAQSVVQTALGGHQSVKDYLVPGGRIYDQRELVYN
MLNDIPGITAVKPKAAFYIFPKIDVKKFNIHSDEQFALDLLHDKHILISHGGAFNWQEPD
HFRVVYLPRISMLKETIGEIGDFFSTYWQA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatcattctcgaccagattgaatgatgccatggcattacgcgagcttaaacag
attgatttcgttcatgctgcggaaaagttcaatatcaagctcggcaaaagccatatgagc
caatacgtcagtggcaaaaccgttccccgtgccgatatcgcgcatttccttgccgcgtat
ctgcgggtcaacgaggattggctgatgggcaaggatgttcccatggaagagcatgccgcg
attttgccggattttgccggtgaacagcccgaccatgttgacgatgcatccgagcaaccg
acagaaggaagaaccatgcgcacttttacgaaatcccacaagctcgacaatgtgctgtac
gacgtccgtggaccggtcgccgacgaggccgcgcgcatggaggccgccggcacgcacatc
ctgaaactcaatatcggcaatccggcaccgttcggcttccgcacgccggatgaagtggtc
tacgacatgtcgcagcagctgcccgacacggaaggctattcgccgtcgaagggcctgttc
tccgcgcgcaaagccatcatgcagtatgcgcagctgaagaacatccccaacgtgtccatc
gacgacatctacaccggcaacggcgtcagcgaacttatcaacctgtccttatccgcgttg
ctggacaacggcgacgaggtactcgtgccgtcgccggattatccgctgtggacagcttgc
gtgaatctggccggcggaaccgcggtgcattacgtctgcgatgaggattccgaatggtat
ccggacatcgacgacatgcgttccaagattaccgacaagaccaaggcgatcgtcatcatc
aatccgaacaatccgaccggcgcgctgtatccgaaggaagtgcttcagcagattgtcgat
cttgcgcgagagcaccagctcatgatcttctcggatgagatctacgaccgtctggtcatg
gatgggttggagcacatctccatcgcgtcccttgcgcctgacctgttctgcgtgacgttc
tccggattgtcgaagtcccatatgatcgccggctggcgtgtcggctggatggtgctgagc
ggcaacaagcgtctcgccaaggattacatcgagggtctgaacatgctggccaacatgcgt
atgtgctcgaacgtgcctgcgcagtcggtggtgcagaccgcattgggcggccatcaaagc
gtcaaggattatctggtgcccggcggccgcatctacgatcagcgcgagttggtgtacaac
atgctcaacgatattccaggcatcaccgcggtcaaaccgaaagcggcgttctacatcttc
ccgaagatcgatgtgaagaagttcaacatccattccgatgagcagttcgcgcttgacctg
ctgcatgacaagcatatcctcatcagccacggcggtgcgttcaactggcaggagccggac
cacttccgtgtggtctatctgcctcgtatcagcatgttgaaggagaccatcggcgagatc
ggcgacttcttcagcacgtattggcaggcttga

DBGET integrated database retrieval system