KEGG   Bifidobacterium adolescentis: BAD_0834Help
Entry
BAD_0834          CDS       T00437                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bad  Bifidobacterium adolescentis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAD_0834 (tpiA)
   01230 Biosynthesis of amino acids
    BAD_0834 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAD_0834 (tpiA)
   00051 Fructose and mannose metabolism
    BAD_0834 (tpiA)
   00562 Inositol phosphate metabolism
    BAD_0834 (tpiA)
Enzymes [BR:bad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAD_0834 (tpiA)
Exosome [BR:bad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAD_0834 (tpiA)
  Exosomal proteins of bladder cancer cells
   BAD_0834 (tpiA)
  Exosomal proteins of melanoma cells
   BAD_0834 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1041321..1042115)
Genome map
AA seq 264 aa AA seqDB search
MGPKRIPLVAGNWKMNFDHLEATYFVQQLAWNLRAIHFDYKRCEIALMPSFTSLRSVQVA
VESDNLKIRYGAQAVSVTSQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESYEERRKGIELDFAVGQVHDVTRDLSDEEAAKLIVAYEPVWA
IGTGMVATPQSAQDAARAIRNDLSDTFGTRVGETVRILYGGSVSSKNAVELINEPDVDGF
LIGGSALKVDELTRICKLTLETTA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggggccgaaacggattcctttggtggccggaaactggaagatgaatttcgatcatctt
gaagcgacgtatttcgtacagcagcttgcatggaatcttcgggccatccatttcgactac
aaacgttgcgaaatcgcattgatgccgtcattcacctcactccgcagcgtgcaggtcgcc
gtcgaatcggacaatctgaaaatccgctacggggcccaagccgtctcagtcacctcgcag
ggagcgttcaccggcgacgtctccgccgatatgatcgcccatctcggctgctcgtacgtg
atcgtcggccattcggaacgacgcaaataccatcccgaagacgacgcgaacatcgtcgac
caggtgagggccgtgcttgctgccggcatgcagccgatactttgcgtcggagaaagctac
gaggaacggcgcaaaggcatagagctcgatttcgcggtcggccaggtgcacgacgtgacg
cgggacctgtccgatgaggaggccgcgaagctgattgtggcgtacgagccggtatgggcg
atcggcaccggcatggtggctacgcctcagtcggcacaggacgcggccagggcgatccga
aacgacctgtccgatacgttcggaacacgggtcggcgaaacggtgcgaatcctgtacggc
ggttcggtgtcctcgaaaaacgcggtggaactgatcaacgagccggatgtggacggcttc
ctgatcggcggctccgcgttgaaggtcgatgaactcacacgcatctgcaagctgacattg
gaaacaaccgcctga

DBGET integrated database retrieval system