KEGG   Bifidobacterium adolescentis: BAD_0867Help
Entry
BAD_0867          CDS       T00437                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bad  Bifidobacterium adolescentis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAD_0867
   01230 Biosynthesis of amino acids
    BAD_0867
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAD_0867
  Energy metabolism
   00680 Methane metabolism
    BAD_0867
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAD_0867
Enzymes [BR:bad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAD_0867
Exosome [BR:bad04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAD_0867
  Exosomal proteins of melanoma cells
   BAD_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1083230..1084006)
Genome map
AA seq 258 aa AA seqDB search
MQGQIDIPLDIVGRWQADQSAYELAKTYYWAKVAHLAEHNDQLAQPTYEGAHLADISEIN
NAPATARRMLVVSSDLFRAQQTAHAFADLMGLDVELDPRLRERSFGEWEGMTREEICEHY
ADDYHSWRAHTGGETKHGVESRIHTGRRGAEAVRDIVAKHHDETMPTTLLLVGHGSWIVA
TVAVLLDMDPDDLNNVGAMRNAFWTRMTPHTDPRNADRPTWKLEEFNQGPAIASFADWEN
GPESLRAPGMPLWKPIIQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ctgcaaggacaaatcgacattcccctcgacatcgtcggacggtggcaggcggaccaaagc
gcgtacgaactcgccaaaacctactattgggcgaaagtcgcgcatctcgccgaacataac
gaccagctcgcgcaacccacgtatgaaggcgcgcatctcgcagacatcagcgaaatcaac
aacgcgcccgccacggcccgccgcatgctcgtcgtctcatcggatctgttccgcgcgcag
cagaccgcgcacgccttcgccgacctcatggggctggacgtggaactcgacccgcgtctg
cgcgaacgcagcttcggcgaatgggagggcatgacccgcgaggagatctgcgagcattac
gccgacgactaccattcctggcgcgcccacacgggaggcgaaaccaagcatggcgtggaa
agccgcatccatacgggccgacgcggcgcggaagccgtgcgcgacatcgtcgccaaacac
catgacgagacaatgcctaccacattgcttctcgtcggccacggctcatggatcgtggcc
accgtggcggtgctgctcgacatggaccccgacgatctcaacaacgtcggcgcgatgcgc
aacgccttctggacgcgcatgaccccgcacaccgaccccaggaacgcggaccgtcccact
tggaagcttgaggaattcaaccaaggccccgccatcgcatcattcgccgactgggagaac
ggtcccgaatcgttgcgcgcgcccggcatgccgctgtggaagccgatcatccaataa

DBGET integrated database retrieval system