KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0869Help
Entry
BAD_0869          CDS       T00437                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAD_0869
   01230 Biosynthesis of amino acids
    BAD_0869
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAD_0869
  Energy metabolism
   00680 Methane metabolism
    BAD_0869
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAD_0869
Enzymes [BR:bad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAD_0869
Exosome [BR:bad04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAD_0869
  Exosomal proteins of melanoma cells
   BAD_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1085539..1086234)
Genome map
AA seq 231 aa AA seqDB search
MTPHVRSITLVRHGRTAYNAQHRLQGQIDIPLDEVGMWQVRQTASALRELYVDRHPEAAC
QLVVCSDLKRAAATAHAFADPLGLDVHPDVRVRERSFGDWEGIAVEELAKRFPEDYLSWA
QFRGGELKYGAEPKQNVGRRGVEALNDWASKAGSDTDLYVFSHGAWISQTLQTLLGLSEV
HGDFADILSMRNAHWVRLAPLELQGALRWRLVDYNHGPAIADTEQWEHPQL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacgccacacgtgcgttccatcacactggtgcgccacggacgcaccgcatacaacgcg
cagcacaggctgcagggacagatcgacattccgctcgacgaagtgggtatgtggcaggtt
cgccagaccgcgtccgcattgcgtgaactgtacgtggaccgtcatcccgaagcggcatgc
cagctggtcgtctgctccgatctcaaacgcgcggccgccaccgcccacgcgttcgccgac
ccgctcggactcgacgtgcatcccgacgtccgtgtgcgagaacgcagcttcggcgattgg
gaaggcatcgccgtcgaagagctcgccaaacggttccccgaggattatctgtcatgggcc
cagttccgcggcggcgagctcaagtatggcgcagaaccgaagcagaacgtcggcaggcgt
ggcgtcgaggcgttgaacgattgggcgtcgaaggccggctccgataccgacctgtacgtg
ttctcgcatggtgcctggatctcgcagacgttgcagacgctgctgggattgagcgaagtg
catggcgatttcgccgacattctgtcgatgcgcaacgcgcattgggtgcggctggcgccg
ttggaactacagggcgcgctgcggtggcgtctggtcgactacaaccatggtccggcgatc
gccgacaccgagcagtgggagcatccgcagctatag

DBGET integrated database retrieval system