KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0869Help
Entry
BAD_0869          CDS       T00437                                 

Definition
(GenBank) hypothetical protein
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Brite
Enzymes [BR:bad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BAD_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1085539..1086234)
Genome map
AA seq 231 aa AA seqDB search
MTPHVRSITLVRHGRTAYNAQHRLQGQIDIPLDEVGMWQVRQTASALRELYVDRHPEAAC
QLVVCSDLKRAAATAHAFADPLGLDVHPDVRVRERSFGDWEGIAVEELAKRFPEDYLSWA
QFRGGELKYGAEPKQNVGRRGVEALNDWASKAGSDTDLYVFSHGAWISQTLQTLLGLSEV
HGDFADILSMRNAHWVRLAPLELQGALRWRLVDYNHGPAIADTEQWEHPQL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacgccacacgtgcgttccatcacactggtgcgccacggacgcaccgcatacaacgcg
cagcacaggctgcagggacagatcgacattccgctcgacgaagtgggtatgtggcaggtt
cgccagaccgcgtccgcattgcgtgaactgtacgtggaccgtcatcccgaagcggcatgc
cagctggtcgtctgctccgatctcaaacgcgcggccgccaccgcccacgcgttcgccgac
ccgctcggactcgacgtgcatcccgacgtccgtgtgcgagaacgcagcttcggcgattgg
gaaggcatcgccgtcgaagagctcgccaaacggttccccgaggattatctgtcatgggcc
cagttccgcggcggcgagctcaagtatggcgcagaaccgaagcagaacgtcggcaggcgt
ggcgtcgaggcgttgaacgattgggcgtcgaaggccggctccgataccgacctgtacgtg
ttctcgcatggtgcctggatctcgcagacgttgcagacgctgctgggattgagcgaagtg
catggcgatttcgccgacattctgtcgatgcgcaacgcgcattgggtgcggctggcgccg
ttggaactacagggcgcgctgcggtggcgtctggtcgactacaaccatggtccggcgatc
gccgacaccgagcagtgggagcatccgcagctatag

DBGET integrated database retrieval system