KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0903Help
Entry
BAD_0903          CDS       T00437                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAD_0903 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAD_0903 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAD_0903 (thrC)
Enzymes [BR:bad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAD_0903 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122750..1124237
Genome map
AA seq 495 aa AA seqDB search
MTTFHSTRSTTDSLTSKQAIRKGIADDGGLFVTDSLGETHVDIASLAGKSYQQIAFDVLS
VLLPDYTEAELKECIDEAYGPQWSDEKITPVKPLGDDYVMELFNGPTSAFKDVALQILPR
FMARTTPADGDADEKIMIVTATSGDTGKAALAGFADAAGTGITVFYPEGKVSQVQELQMT
TQSGSNVNVCAVKGNFDDAQSAVKRIFGDKELAGRLADDSHVVLSSANSINVGRLVPQVV
YYFSAYAQLLERQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVLF
DFLTSGTYNRQRPFFQTISPSMDILISSNLERMLYYMSDKDTRLISMLMNDLSQWGAYEV
PEPMMKKIRSIFGTGWADENQVREMIADCWNKNHYVIDPHTACGYYVMQQMPRDPLTPRV
LLSTASPYKFPRVVNESLGLDASGTDFECMDVLAKATGTTAPAALRGLETANVRFDNVVE
IDGMEGFVEQAAKAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgttccacagcacacgcagcaccaccgattcgcttacctccaagcaggccatc
cgcaagggcatcgccgatgatggcggcctgttcgtgaccgactccttgggtgagacccat
gtggatatcgcttccttggccggcaagtcctaccagcagatcgcgttcgatgtgctgtcc
gtgctgctgccggactacaccgaggccgagctcaaggagtgcatcgacgaggcgtacggc
ccgcagtggtccgacgagaagatcactccggtcaagccgctcggcgatgactatgtgatg
gaactgttcaacggtccgacttccgcgttcaaagatgtggcgctgcagattctgccgcgt
ttcatggcgcgcaccactccggcggatggcgacgcggatgagaagatcatgatcgtcacc
gccacgtccggcgacaccggcaaggccgcgttggctggtttcgcggacgccgcgggcacc
ggcatcaccgtgttctatccggaaggcaaggtcagccaggtgcaggagctgcagatgacc
acgcagtccggctccaatgtgaacgtgtgcgcggtcaagggcaatttcgatgacgcgcag
tccgccgtcaagcgcatcttcggcgacaaggagcttgccggacgtctcgccgatgattcg
catgtggtgctttcctccgcgaattccatcaatgtgggccgtctggtgccgcaggtcgtc
tattacttctccgcgtacgcgcagctgctggaacgccaggtcatcaatgtgggcgacgag
gtcgagttcgttgtgccgacgggtaatttcggcgacatcctcgccggctattacgcgaaa
ctgctgggcctgccggtcaagcatcttgtggtggcgtccgacaagaacaacgtgctgttc
gacttcctgacttccggcacgtacaaccgtcagcgtccgttcttccagaccatttccccg
tcgatggatatcctcatctcatcgaacctggagcgcatgctgtattacatgtccgacaag
gacacacgcctgatctccatgctgatgaacgatctgagccagtggggcgcctacgaggtt
cccgagccgatgatgaagaagattcgttccatcttcggcaccggttgggccgatgagaac
caggtgcgcgagatgatcgcggactgctggaacaagaaccattacgtgatcgacccgcac
accgcatgcggctactacgtcatgcagcagatgccgcgcgatccgctcacgccgcgcgtg
ctgctgtccaccgccagcccgtacaagttcccgcgcgtagtcaacgaatctctgggtctt
gacgcgtccggcaccgatttcgaatgcatggacgtgcttgccaaggccaccggcaccacc
gctccggccgcgctgcgcggtcttgagaccgccaacgtgcgtttcgataacgtcgtcgaa
atcgacggcatggaaggattcgtcgagcaggccgcgaaggcgctgtaa

DBGET integrated database retrieval system