KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0957Help
Entry
BAD_0957          CDS       T00437                                 

Gene name
ppgK
Definition
(GenBank) similar to Mycobacterium tuberculosis polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00010  Glycolysis / Gluconeogenesis
bad00520  Amino sugar and nucleotide sugar metabolism
bad01100  Metabolic pathways
bad01110  Biosynthesis of secondary metabolites
bad01120  Microbial metabolism in diverse environments
bad01130  Biosynthesis of antibiotics
bad01200  Carbon metabolism
Module
bad_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAD_0957 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    BAD_0957 (ppgK)
Enzymes [BR:bad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BAD_0957 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAF39738
UniProt: A1A205
Position
complement(1190266..1191033)
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEVSTPKAVGEIVRQQLEHFEV
PESAPVGIAFPAPIHVGEKLGYMANLDQSWVGVDVTEVFSEACGRPVTVVNDADAAGLAE
QQFGAAKGQDGLVIATTLGTGIGTALIFNGELIPNTELGHLELLKGKGDAEKYAASSIRE
KLDMGYKKWAKRLTKYYSLMEFYFDPQLFVVGGGVSRVSEKFLPYIDIKTPIVAAKLHNE
AGIIGAAYYASTKQK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgagactgcacaggcattcggcgttgacattggtggctccggaattaaggccgcc
ccggttaacctcgagaagggcgagttcgccgaaccgcgtctgaagatcctcaccccggag
gtgtccactccgaaggccgtcggcgaaatcgttcgccagcagctcgagcatttcgaggtt
ccggagtccgctccggtcggcatcgccttcccggctccgattcatgtgggcgaaaagctt
ggctacatggccaacctggaccagtcctgggtcggcgtggacgtcaccgaagtgttctcc
gaagcttgcggtcgtccggtcaccgtggtgaacgacgctgacgccgccggtcttgccgag
cagcagttcggcgccgcgaagggccaggatggcctcgtcatcgccaccacgctgggcacc
ggcatcggcaccgcgctgattttcaacggcgagctcattccgaacaccgagctcggccat
ctggaactgctcaagggcaagggcgacgcggagaagtacgccgcatcctccatccgcgag
aagctcgacatgggctacaagaagtgggcgaagcgcctgaccaagtactactccctcatg
gagttctacttcgacccgcagctgttcgtcgtcggcggtggcgtgtcccgcgtctccgag
aagttcctgccgtacatcgacatcaagaccccgatcgtcgcagccaagctgcacaacgag
gccggcatcatcggcgccgcatactacgcgagcaccaagcagaagtga

DBGET integrated database retrieval system