KEGG   Bifidobacterium adolescentis: BAD_1077Help
Entry
BAD_1077          CDS       T00437                                 

Gene name
asnH
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bad  Bifidobacterium adolescentis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bad00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1335874..1337760)
Genome map
AA seq 628 aa AA seqDB search
MCGIAGFVNDMPIDVKCPVLQRMTDMIAHRGPDSEGHYIDEHAALGHRRLSIIDLGGGQQ
PIYNEDGSKVITFNGEIYNYQTLREELIAAGHTFTTKSDTEVLLHGYEQWGVDLLQRVRG
MFTFVIWDKNKQELFGARDHFGIKPFYYAKMNGTFMYASEIKSLLRHPDFVKELNAEALK
PYMTFQYPAIGETFFKGVYKLPEGHYFTYRDGKMDIHRYYDEDFREGKQKLGELVNSIDQ
TVCDSVKAHQIADVEVGSFLSSGVDSSYVAAVARPQHTYSIGFGKGTYNESQQAGELAEL
LKLNNTAESLTDEEAFAAFPRIQWHLDEPDSNPSCVPLYFLSALAAKDVKVVLSGEGADE
LFAGYIDYGVHTKFKPIKVVTRWLTHLPAGARKAIARFCKGKTFPGAWHLYANLAPAEES
FIGQARVFEESQSEQLLKPEYRKAPSVQSIVDKTYARVEGKGLSELKKKQYLDMHQWMPG
DILLKADKMTMAHSLELRVPLLDKELMGVAEQVPTKYLITDENTKYAFRQAAGRHLPKEW
YDREKLGFPVPIKKWLREEKFYKYVRSVFERDYVSQFFDQDALLKMIDDNYAGKTDDRRK
IWTVYSFLTWYDVYFVHDGEKPDVIAIA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgctggtttcgtcaacgatatgcccattgacgtgaaatgcccggtcctc
caacgtatgaccgacatgatcgcgcatcgcgggccggacagcgaaggccattacatcgac
gagcatgcggcgctcggccatcgaaggctcagcatcatcgacctcggcggcggccagcag
cccatctacaacgaggatggttcgaaggtcatcaccttcaacggcgagatctacaactat
cagacgctgcgtgaggaattgatcgcggccggacacaccttcaccaccaaaagcgacacc
gaggtgctgctgcacggctatgagcagtggggtgtggatttgctgcagcgcgtacgtggc
atgttcactttcgtgatctgggacaagaacaagcaggaactgttcggcgcgcgcgaccat
ttcggcatcaagcccttctactatgcgaagatgaacggcacgttcatgtacgcgtcggag
atcaagagcctgttgcgccaccccgatttcgtcaaggagctcaacgccgaggcgttgaag
ccgtatatgaccttccagtatccggcgatcggtgagaccttcttcaaaggcgtctacaag
ctgccggaagggcactatttcacgtaccgggatggcaagatggacatccaccggtattac
gacgaggatttccgcgaaggcaagcagaagctgggcgagctggtgaactcgatcgaccag
acggtgtgcgattccgtcaaggcgcaccagatcgccgatgtggaggtcggctccttcctg
tcgagcggtgtcgactccagctacgtcgccgccgtggcgcgtccgcagcacacgtattcg
atcggttttggcaaaggcacgtacaacgaatcgcagcaggccggcgaactggcggaactg
ctcaaactgaacaacaccgccgagtcgttgaccgacgaggaggcgttcgccgcgttcccg
cgcatccaatggcatctcgacgagccggactccaatccgagctgcgtgccgctgtacttc
ctgtccgcattggccgccaaagacgtgaaggtggtgctgagcggcgaaggcgccgacgag
ttgttcgccggatacatcgactacggcgtgcacaccaaattcaagcccatcaaggtggtg
actcgctggctcacgcatctgccagccggcgcgcgcaaggcgatcgcccggttctgcaag
ggcaagaccttcccgggcgcatggcatctgtacgccaatcttgcgccggccgaggaaagc
ttcatcggacaggcacgtgtgtttgaggaatcgcagtccgaacagctgctcaagcctgaa
taccgcaaggcgccgagcgtgcaaagcatcgtcgacaagacgtatgcgcgtgtggaaggc
aagggtctgagcgaactgaagaagaagcagtaccttgacatgcatcagtggatgccgggt
gacattctgctcaaggccgacaagatgaccatggcgcattcgctggaattgcgtgtgccg
ctgctcgacaaggagctcatgggcgtggccgagcaggtgccgaccaagtacctcatcacc
gacgagaacacgaaatacgcgttccgccaggcggcgggacgtcatctgcccaaggaatgg
tacgaccgtgagaagcttggcttcccggtgccgatcaagaagtggctgcgtgaggagaag
ttctacaagtacgtccgttccgtgttcgaacgcgattacgtcagccagttcttcgaccag
gacgcgctgctgaagatgatcgatgacaactatgccggcaaaaccgacgatcgccgcaag
atctggaccgtgtactcgttcctgacgtggtacgacgtctacttcgtgcacgacggcgag
aagccagacgtcatcgccatcgcctga

DBGET integrated database retrieval system